OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Rab5 (RAB5A) (NM_004162) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC203873
RAB5A (Myc-DDK-tagged)-Human RAB5A, member RAS oncogene family (RAB5A)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
5 Days*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA812808 RAB5A mouse monoclonal antibody,clone OTI6D9 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Rab5 or NM_004162"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Rab5
Synonyms RAB5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203873 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTAGTCGAGGCGCAACAAGACCCAACGGGCCAAATACTGGAAATAAAATATGCCAGTTCAAACTAG
TACTTCTGGGAGAGTCCGCTGTTGGCAAATCAAGCCTAGTGCTTCGTTTTGTGAAAGGCCAATTTCATGA
ATTTCAAGAGAGTACCATTGGGGCTGCTTTTCTAACCCAAACTGTATGTCTTGATGACACTACAGTAAAG
TTTGAAATATGGGATACAGCTGGTCAAGAACGATACCATAGCCTAGCACCAATGTACTACAGAGGAGCAC
AAGCAGCCATAGTTGTATATGATATCACAAATGAGGAGTCCTTTGCAAGAGCAAAAAATTGGGTTAAAGA
ACTTCAGAGGCAAGCAAGTCCTAACATTGTAATAGCTTTATCGGGAAACAAGGCCGACCTAGCAAATAAA
AGAGCAGTAGATTTCCAGGAAGCACAGTCCTATGCAGATGACAATAGTTTATTATTCATGGAGACATCCG
CTAAAACATCAATGAATGTAAATGAAATATTCATGGCAATAGCTAAAAAATTGCCAAAGAATGAACCACA
AAATCCAGGAGCAAATTCTGCCAGAGGAAGAGGAGTAGACCTTACCGAACCCACACAACCAACCAGGAAT
CAGTGTTGTAGTAAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC203873 protein sequence
Red=Cloning site Green=Tags(s)

MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVK
FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANK
RAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRN
QCCSN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_004162
ORF Size 645 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004162.3, NP_004153.2
RefSeq Size 2548 bp
RefSeq ORF 648 bp
Locus ID 5868
UniProt ID P20339
Cytogenetics 3p24.3
Domains RAB, RAN, ras, RAS, RHO
Protein Families Druggable Genome
Protein Pathways Amyotrophic lateral sclerosis (ALS), Endocytosis
MW 23.7 kDa
Summary The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB5A is required for the fusion of plasma membranes and early endosomes (PubMed:10818110, PubMed:14617813, PubMed:16410077, PubMed:15378032). Contributes to the regulation of filopodia extension (PubMed:14978216). Required for the exosomal release of SDCBP, CD63, PDCD6IP and syndecan (PubMed:22660413). Regulates maturation of apoptotic cell-containing phagosomes, probably downstream of DYN2 and PIK3C3 (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_004162" in other vectors (7)
SKU Description Size Price
RC203873L1 Lenti ORF clone of Human RAB5A, member RAS oncogene family (RAB5A), Myc-DDK-tagged 10 ug
$600.00
RC203873L2 Lenti ORF clone of Human RAB5A, member RAS oncogene family (RAB5A), mGFP tagged 10 ug
$600.00
RC203873L3 Lenti ORF clone of Human RAB5A, member RAS oncogene family (RAB5A), Myc-DDK-tagged 10 ug
$600.00
RC203873L4 Lenti ORF clone of Human RAB5A, member RAS oncogene family (RAB5A), mGFP tagged 10 ug
$600.00
RG203873 RAB5A (tGFP-tagged) - Human RAB5A, member RAS oncogene family (RAB5A) 10 ug
$489.00 $500.00
SC117557 RAB5A (untagged)-Human RAB5A, member RAS oncogene family (RAB5A) 10 ug
$450.00
SC322309 RAB5A (untagged)-Human RAB5A, member RAS oncogene family (RAB5A) 10 ug
$450.00

Plasmid Map for RC203873

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC203873
Circular map for RC203873

file-alt Citations

Alpha-synuclein inhibits the secretion of extracellular vesicles through disruptions in YKT6 lipidation
Tsunemi, Ishiguro, Yoroisaka et al
J Neurosci (2025)
AI Summary: OriGene products contributed to this study by providing expression plasmids for RAB11 (RC200352), RAB27B (RC206519), RAB5A (RC203873), and YKT6 (RC200260), which were used to investigate the molecular mechanisms underlying alpha-synuclein-induced disruptions in extracellular vesicle secretion.
Snippet: ssed within the cells (Cheng et al., 128 2018). The expression plasmids for RAB11 (RC200352), RAB27B (RC206519), RAB5A 129 (RC203873), and YKT6 (RC200260) were purchased from OriGene. YKT6 cDNA was inserted 130 in the pEGFP-N1 or pET21 vector
Rab5a is overexpressed in oral cancer and promotes invasion through ERK/MMP signaling
Zhang, Lu, Ai
Mol Med Rep (2017)
AI Summary: In this study, the Rab5a plasmid from OriGene Technologies was used to overexpress Rab5a in oral cancer cells, enabling the researchers to investigate its role in promoting cell growth, invasion, and activation of the ERK/MMP signaling pathway.
Snippet: VA, USA. Cells were cultured in DMEM (Invitrogen, Carlsbad, CA, USA) with 10% FBS (Gibco, Grand Island, NY, USA). Rab5a plasmid was obtained from OriGene Technologies, Inc. (Rockville, MD, USA). Lipofectamine 3000 ... All 2 versions Cite SaveSaving
Expression of Rab5a correlates with tumor progression in pancreatic carcinoma
Li, Sun, Ji et al
Virchows Arch. (2017)
AI Summary: OriGene contributed to this study by providing the pCMV6-Rab5a plasmid, which was used to overexpress Rab5a in pancreatic cancer cell lines to investigate its role in tumor progression.
Snippet: The siGEMONE siRNA pool for Rab5a was obtained from Dharmacon (Dharmacon, CO, USA). siGEMONE Non-Targeting siRNA pool was used as control. pCMV6-Rab5a plasmid was obtained from Origene com- pany (Origene, Rockville, USA). Attractene reagent ... All 2 versions Cite SaveSaving
Modulation of insulin signalling and calcium homeostasis by endosomes in pancreatic beta-cells
Albrecht
Thesis (2015)
Snippet: … To generate TagBFP-Rab5a, human Rab5a cDNA was PCR amplified from pCMV6-Entry-Rab5A (Origene, Rockville, MD) using primers #15,#16 and inserted into pTagBFP-C using SacI and BamHI restriction sites. To generate TagBFP-Rab7, human Rab7 cDNA was PCR amplified from pCMV6-Entry-Rab7 (Origene) using primers #17,#18 and inserted into pTagBFP-C using SacI and BamHI restriction sites. …
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products