Rab5 (RAB5A) (NM_004162) Human Tagged ORF Clone

SKU
RG203873
RAB5A (tGFP-tagged) - Human RAB5A, member RAS oncogene family (RAB5A)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
5 Days*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Rab5
Synonyms RAB5
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203873 representing NM_004162
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTAGTCGAGGCGCAACAAGACCCAACGGGCCAAATACTGGAAATAAAATATGCCAGTTCAAACTAG
TACTTCTGGGAGAGTCCGCTGTTGGCAAATCAAGCCTAGTGCTTCGTTTTGTGAAAGGCCAATTTCATGA
ATTTCAAGAGAGTACCATTGGGGCTGCTTTTCTAACCCAAACTGTATGTCTTGATGACACTACAGTAAAG
TTTGAAATATGGGATACAGCTGGTCAAGAACGATACCATAGCCTAGCACCAATGTACTACAGAGGAGCAC
AAGCAGCCATAGTTGTATATGATATCACAAATGAGGAGTCCTTTGCAAGAGCAAAAAATTGGGTTAAAGA
ACTTCAGAGGCAAGCAAGTCCTAACATTGTAATAGCTTTATCGGGAAACAAGGCCGACCTAGCAAATAAA
AGAGCAGTAGATTTCCAGGAAGCACAGTCCTATGCAGATGACAATAGTTTATTATTCATGGAGACATCCG
CTAAAACATCAATGAATGTAAATGAAATATTCATGGCAATAGCTAAAAAATTGCCAAAGAATGAACCACA
AAATCCAGGAGCAAATTCTGCCAGAGGAAGAGGAGTAGACCTTACCGAACCCACACAACCAACCAGGAAT
CAGTGTTGTAGTAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203873 representing NM_004162
Red=Cloning site Green=Tags(s)

MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVK
FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANK
RAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRN
QCCSN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004162
ORF Size 645 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004162.3, NP_004153.2
RefSeq Size 2352 bp
RefSeq ORF 648 bp
Locus ID 5868
UniProt ID P20339
Cytogenetics 3p24.3
Domains RAB, RAN, ras, RAS, RHO
Protein Families Druggable Genome
Protein Pathways Amyotrophic lateral sclerosis (ALS), Endocytosis
Summary The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB5A is required for the fusion of plasma membranes and early endosomes (PubMed:10818110, PubMed:14617813, PubMed:16410077, PubMed:15378032). Contributes to the regulation of filopodia extension (PubMed:14978216). Required for the exosomal release of SDCBP, CD63, PDCD6IP and syndecan (PubMed:22660413). Regulates maturation of apoptotic cell-containing phagosomes, probably downstream of DYN2 and PIK3C3 (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Rab5 (RAB5A) (NM_004162) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203873 RAB5A (Myc-DDK-tagged)-Human RAB5A, member RAS oncogene family (RAB5A) 10 ug
$300.00
RC203873L1 Lenti ORF clone of Human RAB5A, member RAS oncogene family (RAB5A), Myc-DDK-tagged 10 ug
$600.00
RC203873L2 Lenti ORF clone of Human RAB5A, member RAS oncogene family (RAB5A), mGFP tagged 10 ug
$600.00
RC203873L3 Lenti ORF clone of Human RAB5A, member RAS oncogene family (RAB5A), Myc-DDK-tagged 10 ug
$600.00
RC203873L4 Lenti ORF clone of Human RAB5A, member RAS oncogene family (RAB5A), mGFP tagged 10 ug
$600.00
SC117557 RAB5A (untagged)-Human RAB5A, member RAS oncogene family (RAB5A) 10 ug
$450.00
SC322309 RAB5A (untagged)-Human RAB5A, member RAS oncogene family (RAB5A) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.