OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PHAX (NM_032177) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC203376
PHAX (Myc-DDK-tagged)-Human phosphorylated adaptor for RNA export (PHAX)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA370893 PHAX rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "PHAX or NM_032177"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PHAX
Synonyms RNUXA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203376 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTTGGAGGTCGGCGATATGGAAGATGGGCAGCTTTCCGACTCGGATTCCGACATGACGGTCGCAC
CCAGCGACAGGCCGCTGCAATTGCCAAAAGTGCTAGGTGGCGACAGTGCTATGAGGGCCTTCCAGAACAC
GGCAACTGCATGTGCACCAGTATCACATTATCGAGCTGTTGAAAGTGTGGATTCAAGTGAAGAAAGTTTT
TCTGATTCAGATGATGATAGCTGTCTTTGGAAACGCAAACGACAGAAATGTTTTAACCCTCCTCCCAAAC
CAGAGCCTTTTCAGTTTGGCCAGAGCAGTCAGAAACCACCTGTTGCTGGAGGAAAGAAGATTAACAACAT
ATGGGGTGCTGTGCTGCAGGAACAGAATCAAGATGCAGTGGCCACTGAACTTGGTATCTTGGGAATGGAG
GGCACTATTGACAGAAGCAGACAATCCGAGACCTACAATTATTTGCTTGCCAAGAAACTTAGGAAGGAAT
CTCAAGAGCATACAAAAGATCTAGACAAGGAACTAGATGAATATATGCATGGTGGCAAAAAAATGGGATC
AAAGGAAGAGGAAAATGGGCAAGGTCATCTCAAAAGGAAACGACCTGTCAAAGACAGGCTAGGGAACAGA
CCAGAAATGAACTATAAAGGTCGATACGAGATCACAGCGGAAGATTCTCAAGAGAAAGTGGCTGATGAAA
TTTCATTCAGGTTACAGGAACCAAAGAAAGACCTGATAGCCCGAGTAGTGAGGATTATTGGTAACAAAAA
GGCAATTGAACTTCTGATGGAAACCGCTGAAGTTGAACAAAATGGTGGTCTCTTTATAATGAATGGTAGT
CGAAGAAGAACACCAGGTGGAGTTTTTCTGAATCTCTTGAAAAACACTCCTAGTATCAGCGAGGAACAAA
TTAAGGACATTTTCTACATTGAAAACCAAAAGGAATATGAAAATAAAAAAGCTGCTAGGAAGAGGAGAAC
ACAAGTGTTGGGGAAAAAGATGAAACAAGCTATTAAAAGTCTAAATTTTCAAGAAGATGATGATACATCA
CGAGAAACTTTTGCAAGTGACACGAATGAGGCCTTGGCCTCTCTTGATGAGTCACAGGAAGGACATGCAG
AAGCCAAGTTGGAGGCAGAGGAAGCCATTGAAGTTGATCATTCTCATGATTTGGACATCTTT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC203376 protein sequence
Red=Cloning site Green=Tags(s)

MALEVGDMEDGQLSDSDSDMTVAPSDRPLQLPKVLGGDSAMRAFQNTATACAPVSHYRAVESVDSSEESF
SDSDDDSCLWKRKRQKCFNPPPKPEPFQFGQSSQKPPVAGGKKINNIWGAVLQEQNQDAVATELGILGME
GTIDRSRQSETYNYLLAKKLRKESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRPVKDRLGNR
PEMNYKGRYEITAEDSQEKVADEISFRLQEPKKDLIARVVRIIGNKKAIELLMETAEVEQNGGLFIMNGS
RRRTPGGVFLNLLKNTPSISEEQIKDIFYIENQKEYENKKAARKRRTQVLGKKMKQAIKSLNFQEDDDTS
RETFASDTNEALASLDESQEGHAEAKLEAEEAIEVDHSHDLDIF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_032177
ORF Size 1182 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032177.4
RefSeq Size 3641 bp
RefSeq ORF 1185 bp
Locus ID 51808
UniProt ID Q9H814
Cytogenetics 5q23.2
MW 44.4 kDa
Summary A phosphoprotein adapter involved in the XPO1-mediated U snRNA export from the nucleus. Bridge components required for U snRNA export, the cap binding complex (CBC)-bound snRNA on the one hand and the GTPase Ran in its active GTP-bound form together with the export receptor XPO1 on the other. Its phosphorylation in the nucleus is required for U snRNA export complex assembly and export, while its dephosphorylation in the cytoplasm causes export complex disassembly. It is recycled back to the nucleus via the importin alpha/beta heterodimeric import receptor. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Its compartmentalized phosphorylation cycle may also contribute to the directionality of export. Binds strongly to m7G-capped U1 and U5 small nuclear RNAs (snRNAs) in a sequence-unspecific manner and phosphorylation-independent manner (By similarity). Plays also a role in the biogenesis of U3 small nucleolar RNA (snoRNA). Involved in the U3 snoRNA transport from nucleoplasm to Cajal bodies. Binds strongly to m7G-capped U3, U8 and U13 precursor snoRNAs and weakly to trimethylated (TMG)-capped U3, U8 and U13 snoRNAs. Binds also to telomerase RNA.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_032177" in other vectors (4)
SKU Description Size Price
RC203376L3 Lenti ORF clone of Human phosphorylated adaptor for RNA export (PHAX), Myc-DDK-tagged 10 ug
$757.00
RC203376L4 Lenti ORF clone of Human phosphorylated adaptor for RNA export (PHAX), mGFP tagged 10 ug
$757.00
RG203376 PHAX (tGFP-tagged) - Human phosphorylated adaptor for RNA export (PHAX) 10 ug
$489.00 $657.00
SC319313 PHAX (untagged)-Human phosphorylated adaptor for RNA export (PHAX) 10 ug
$457.00

Plasmid Map for RC203376

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC203376
Circular map for RC203376

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products