OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IMPDH2 (NM_000884) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC202977
IMPDH2 (Myc-DDK-tagged)-Human IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $479.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA810973 IMPDH2 mouse monoclonal antibody,clone OTI2F10 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "IMPDH2 or NM_000884"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol IMPDH2
Synonyms IMPD2; IMPDH-II
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202977 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGACTACCTGATTAGTGGGGGCACGTCCTACGTGCCAGACGACGGACTCACAGCACAGCAGCTCT
TCAACTGCGGAGACGGCCTCACCTACAATGACTTTCTCATTCTCCCTGGGTACATCGACTTCACTGCAGA
CCAGGTGGACCTGACTTCTGCTCTGACCAAGAAAATCACTCTTAAGACCCCACTGGTTTCCTCTCCCATG
GACACAGTCACAGAGGCTGGGATGGCCATAGCAATGGCGCTTACAGGCGGTATTGGCTTCATCCACCACA
ACTGTACACCTGAATTCCAGGCCAATGAAGTTCGGAAAGTGAAGAAATATGAACAGGGATTCATCACAGA
CCCTGTGGTCCTCAGCCCCAAGGATCGCGTGCGGGATGTTTTTGAGGCCAAGGCCCGGCATGGTTTCTGC
GGTATCCCAATCACAGACACAGGCCGGATGGGGAGCCGCTTGGTGGGCATCATCTCCTCCAGGGACATTG
ATTTTCTCAAAGAGGAGGAACATGACTGTTTCTTGGAAGAGATAATGACAAAGAGGGAAGACTTGGTGGT
AGCCCCTGCAGGCATCACACTGAAGGAGGCAAATGAAATTCTGCAGCGCAGCAAGAAGGGAAAGTTGCCC
ATTGTAAATGAAGATGATGAGCTTGTGGCCATCATTGCCCGGACAGACCTGAAGAAGAATCGGGACTACC
CACTAGCCTCCAAAGATGCCAAGAAACAGCTGCTGTGTGGGGCAGCCATTGGCACTCATGAGGATGACAA
GTATAGGCTGGACTTGCTCGCCCAGGCTGGTGTGGATGTAGTGGTTTTGGACTCTTCCCAGGGAAATTCC
ATCTTCCAGATCAATATGATCAAGTACATCAAAGACAAATACCCTAATCTCCAAGTCATTGGAGGCAATG
TGGTCACTGCTGCCCAGGCCAAGAACCTCATTGATGCAGGTGTGGATGCCCTGCGGGTGGGCATGGGAAG
TGGCTCCATCTGCATTACGCAGGAAGTGCTGGCCTGTGGGCGGCCCCAAGCAACAGCAGTGTACAAGGTG
TCAGAGTATGCACGGCGCTTTGGTGTTCCGGTCATTGCTGATGGAGGAATCCAAAATGTGGGTCATATTG
CGAAAGCCTTGGCCCTTGGGGCCTCCACAGTCATGATGGGCTCTCTCCTGGCTGCCACCACTGAGGCCCC
TGGTGAATACTTCTTTTCCGATGGGATCCGGCTAAAGAAATATCGCGGTATGGGTTCTCTCGATGCCATG
GACAAGCACCTCAGCAGCCAGAACAGATATTTCAGTGAAGCTGACAAAATCAAAGTGGCCCAGGGAGTGT
CTGGTGCTGTGCAGGACAAAGGGTCAATCCACAAATTTGTCCCTTACCTGATTGCTGGCATCCAACACTC
ATGCCAGGACATTGGTGCCAAGAGCTTGACCCAAGTCCGAGCCATGATGTACTCTGGGGAGCTTAAGTTT
GAGAAGAGAACGTCCTCAGCCCAGGTGGAAGGTGGCGTCCATAGCCTCCATTCGTATGAGAAGCGGCTTT
TC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC202977 protein sequence
Red=Cloning site Green=Tags(s)

MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPM
DTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFC
GIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLP
IVNEDDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNS
IFQINMIKYIKDKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKV
SEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM
DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKF
EKRTSSAQVEGGVHSLHSYEKRLF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_000884
ORF Size 1542 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000884.3
RefSeq Size 1712 bp
RefSeq ORF 1545 bp
Locus ID 3615
UniProt ID P12268
Cytogenetics 3p21.31
Domains CBS, IMPDH
Protein Families Druggable Genome
Protein Pathways Drug metabolism - other enzymes, Metabolic pathways, Purine metabolism
MW 55.8 kDa
Summary This gene encodes the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. The encoded protein catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'-monophosphate. This gene is up-regulated in some neoplasms, suggesting it may play a role in malignant transformation. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_000884" in other vectors (6)
SKU Description Size Price
RC202977L1 Lenti ORF clone of Human IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2), Myc-DDK-tagged 10 ug
$779.00
RC202977L2 Lenti ORF clone of Human IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2), mGFP tagged 10 ug
$779.00
RC202977L3 Lenti ORF clone of Human IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2), Myc-DDK-tagged 10 ug
$779.00
RC202977L4 Lenti ORF clone of Human IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2), mGFP tagged 10 ug
$779.00
RG202977 IMPDH2 (tGFP-tagged) - Human IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2) 10 ug
$489.00 $679.00
SC119585 IMPDH2 (untagged)-Human IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2) 10 ug
$479.00

Plasmid Map for RC202977

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC202977
Circular map for RC202977

file-alt Citations

Cytosolic EZH2-IMPDH2 complexes regulate melanoma progression and metastasis via GTP
Kuser-Abali, Noguchi, Zhao et al
Mol Cell (2026) 86 (13), 2521-2538.e10 DOI: 10.1016/j.molcel.2026.06.003
AI Summary: In this study, the OriGene MYC/FLAG-hIMPDH2 plasmid (Cat#RC202977) was used to investigate the role of IMPDH2 in melanoma progression and its interaction with EZH2.
Snippet: pCMVHA-hEZH2 Bracken et al.26 Addgene Plasmid #24230 MYC/FLAG-hIMPDH2 Origene Cat#RC202977 pLV-EF1a-V5-LIC Cheng et al.94 Addgene Plasmid #120247 pCW-Blast-Cas9 Unpublished Addgene Plasmid #83481
Interaction of ROMK2 channel with lipid kinases DGKE and AGK: Potential channel activation by localized anionic lipid synthesis
Krajewska, Możajew, Filipek et al
Biochim Biophys Acta Mol Cell Biol Lipids (2023) 1869 (2), 159443 DOI: 10.1016/j.bbalip.2023.159443
Cited by 4
AI Summary: OriGene contributed to this study by providing pCMV6-Entry plasmids encoding FLAG-tagged proteins—specifically PRDX1, GPATCH8, TP53, IMPDH2, AGK, PARP1, and DGKE—which were used in co-immunoprecipitation experiments to investigate protein interactions with the ROMK2 channel.
Snippet: ectors with pCMV6-Entry plasmid backbone, which express proteins with Myc-FLAG-tags (in this study referred to as FLAG tag only) for Co-IP were obtained from OriGene for the following proteins: PRDX1 (cat. no. RC205072), GPATCH8 (cat. no. RC219640), TP53 (cat. no. RC200003), IMPDH2 (cat. no. RC202977), AGK (cat. no. RC201891), PARP1 (cat. no. RC207085), DGKE (cat. no. RC219913)
Cytosolic EZH2-IMPDH2 Complexes Regulate Melanoma Progression via GTP
Kuser Abali, Noguchi, Szeto et al
SSRN Journal (2022)
Snippet: pCMVHA hEZH2 (#24230) and pLV-EF1a-V5-LIC (#120247) plasmids were 195 purchased from Addgene and MYC/FLAG-hIMPDH2 (#RC202977) plasmid from 196 Origene. EZH2 (1-170), EZH2 (1-340), EZH2 (1-503), EZH2 (1-605), EZH2 (171-751) 197 deletion mutants, full length EZH2
The cytosolic role of EZH2-IMPDH2 complex in melanoma progression and metastasis via GTP regulation
Abali, Noguchi, Szeto et al
Research Square (2021)
Snippet: pCMVHA hEZH2 (#24230) and pLV-EF1a-V5-LIC (#120247) plasmids were 172 purchased from Addgene and MYC/FLAG-hIMPDH2 (#RC202977) plasmid from 173 Origene. EZH2 (1-170), EZH2 (1-340), EZH2 (1-503), EZH2 (1-605) deletion mutants, 174 full length EZH2 (1-751) and IMPDH2 (1-187) deletion mutant were cloned into pLV175 EF1a-V5-LIC vector backbone’s SrfI/NotI RE using the cloning primers listed in Table
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products