OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OPA3 (NM_025136) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC202959
OPA3 (Myc-DDK-tagged)-Human optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia) (OPA3), nuclear gene encoding mitochondrial protein, transcript variant 2
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA809426 OPA3 mouse monoclonal antibody,clone OTI3G4 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "OPA3 or NM_025136"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol OPA3
Synonyms MGA3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202959 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGTGGGCGCGTTCCCTATGGCGAAGCTGCTATACTTGGGCATCCGGCAGGTCAGCAAGCCGCTTG
CCAACCGTATTAAGGAGGCCGCCCGCCGAAGCGAGTTCTTCAAGACCTATATCTGCCTCCCGCCGGCTCA
ACTGTATCACTGGGTGGAGATGCGGACCAAGATGCGCATCATGGGCTTCCGGGGCACGGTCATCAAGCCG
CTGAACGAGGAGGCGGCAGCCGAGCTGGGCGCAGAGCTGCTGGGCGAAGCCACCATCTTCATCGTGGGCG
GCGGCTGCCTAGTGCTGGAGTACTGGCGCCACCAGGCGCAGCAGCGCCACAAGGAGGAGGAGCAGCGTGC
TGCCTGGAACGCGCTGCGGGACGAGGTGGGCCACCTGGCGCTGGCGCTGGAAGCGCTGCAGGCGCAGGTG
CAGGCGGCGCCGCCACAGGGCGCCCTGGAGGAACTGCGCACAGAGCTGCAAGAGGTGCGCGCCCAGCTCT
GCAATCCCGGCCGGTCCGCTTCCCACGCAGTGCCTGCGTCCAAGAAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC202959 protein sequence
Red=Cloning site Green=Tags(s)

MVVGAFPMAKLLYLGIRQVSKPLANRIKEAARRSEFFKTYICLPPAQLYHWVEMRTKMRIMGFRGTVIKP
LNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQAQV
QAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_025136
ORF Size 537 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025136.1, NP_079412.1
RefSeq Size 7889 bp
RefSeq ORF 540 bp
Locus ID 80207
UniProt ID Q9H6K4
Cytogenetics 19q13.32
MW 20 kDa
Summary The mouse ortholog of this protein co-purifies with the mitochondrial inner membrane. Mutations in this gene have been shown to result in 3-methylglutaconic aciduria type III and autosomal dominant optic atrophy and cataract. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Oct 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_025136" in other vectors (6)
SKU Description Size Price
RC202959L1 Lenti ORF clone of Human optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia) (OPA3), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC202959L2 Lenti ORF clone of Human optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia) (OPA3), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged 10 ug
$600.00
RC202959L3 Lenti ORF clone of Human optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia) (OPA3), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC202959L4 Lenti ORF clone of Human optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia) (OPA3), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged 10 ug
$600.00
RG202959 OPA3 (tGFP-tagged) - Human optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia) (OPA3), nuclear gene encoding mitochondrial protein, transcript variant 2 10 ug
$489.00 $500.00
SC319129 OPA3 (untagged)-Human optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia) (OPA3), nuclear gene encoding mitochondrial protein, transcript variant 2 10 ug
$300.00

Plasmid Map for RC202959

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC202959
Circular map for RC202959

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products