OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PDCD5 (NM_004708) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC202119
PDCD5 (Myc-DDK-tagged)-Human programmed cell death 5 (PDCD5)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $150.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA364544 PDCD5 rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "PDCD5 or NM_004708"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PDCD5
Synonyms TFAR19
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202119 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGACGAGGAGCTTGAGGCGCTGAGGAGACAGAGGCTGGCCGAGCTGCAGGCCAAACACGGGGATC
CTGGTGATGCGGCCCAACAGGAAGCAAAGCACAGGGAAGCAGAAATGAGAAACAGTATCTTAGCCCAAGT
TCTGGATCAGTCGGCCCGGGCCAGGTTAAGTAACTTAGCACTTGTAAAGCCTGAAAAAACTAAAGCAGTA
GAGAATTACCTTATACAGATGGCAAGATATGGACAACTAAGTGAGAAGGTATCAGAACAAGGTTTAATAG
AAATCCTTAAAAAAGTAAGCCAACAAACAGAAAAGACAACAACAGTGAAATTCAACAGAAGAAAAGTAAT
GGACTCTGATGAAGATGACGATTAT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC202119 protein sequence
Red=Cloning site Green=Tags(s)

MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAV
ENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_004708
ORF Size 375 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004708.4
RefSeq Size 604 bp
RefSeq ORF 378 bp
Locus ID 9141
UniProt ID O14737
Cytogenetics 19q13.11
Domains dsDNA_bind
MW 14.3 kDa
Summary This gene encodes a protein that is upregulated during apoptosis where it translocates rapidly from the cytoplasm to the nucleus. The encoded protein may be an important regulator of K(lysine) acetyltransferase 5 (a protein involved in transcription, DNA damage response and cell cycle control) by inhibiting its proteasome-dependent degradation. Pseudogenes have been identified on chromosomes 5 and 12 provided by RefSeq, Dec 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_004708" in other vectors (6)
SKU Description Size Price
RC202119L1 Lenti ORF clone of Human programmed cell death 5 (PDCD5), Myc-DDK-tagged 10 ug
$450.00
RC202119L2 Lenti ORF clone of Human programmed cell death 5 (PDCD5), mGFP tagged 10 ug
$450.00
RC202119L3 Lenti ORF clone of Human programmed cell death 5 (PDCD5), Myc-DDK-tagged 10 ug
$450.00
RC202119L4 Lenti ORF clone of Human programmed cell death 5 (PDCD5), mGFP tagged 10 ug
$450.00
RG202119 PDCD5 (tGFP-tagged) - Human programmed cell death 5 (PDCD5) 10 ug
$489.00
SC117216 PDCD5 (untagged)-Human programmed cell death 5 (PDCD5) 10 ug
$150.00

Plasmid Map for RC202119

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC202119
Circular map for RC202119

file-alt Citations

NF-κB p65 recruited SHP regulates PDCD5-mediated apoptosis in cancer cells
Murshed, Farhana, Dawson et al
Apoptosis (2013)
Cited by 26
AI Summary: OriGene’s Human Myc-DDK-tagged-PDCD5 cDNA expression vector was used in this study to over-express PDCD5 and assess its role in NF-κB p65/SHP-mediated apoptosis in cancer cells.
Snippet: Puromycin was purchased from Sigma-Aldrich (St. Louise, MO). Human Myc-DDK-tagged-PDCD5 cDNA expression vector was purchased from OriGene Technologies Inc. (Rockville, MD). ChIP on chip promoter array analysis and validation. ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products