OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD9 (NM_001769) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC202000
CD9 (Myc-DDK-tagged)-Human CD9 molecule (CD9)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
5 Days*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA813476 CD9 mouse monoclonal antibody, clone OTI3D5 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "CD9 or NM_001769"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CD9
Synonyms BTCC-1; DRAP-27; MIC3; MRP-1; TSPAN-29; TSPAN29
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202000 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGTCAAAGGAGGCACCAAGTGCATCAAATACCTGCTGTTCGGATTTAACTTCATCTTCTGGCTTG
CCGGGATTGCTGTCCTTGCCATTGGACTATGGCTCCGATTCGACTCTCAGACCAAGAGCATCTTCGAGCA
AGAAACTAATAATAATAATTCCAGCTTCTACACAGGAGTCTATATTCTGATCGGAGCCGGCGCCCTCATG
ATGCTGGTGGGCTTCCTGGGCTGCTGCGGGGCTGTGCAGGAGTCCCAGTGCATGCTGGGACTGTTCTTCG
GCTTCCTCTTGGTGATATTCGCCATTGAAATAGCTGCGGCCATCTGGGGATATTCCCACAAGGATGAGGT
GATTAAGGAAGTCCAGGAGTTTTACAAGGACACCTACAACAAGCTGAAAACCAAGGATGAGCCCCAGCGG
GAAACGCTGAAAGCCATCCACTATGCGTTGAACTGCTGTGGTTTGGCTGGGGGCGTGGAACAGTTTATCT
CAGACATCTGCCCCAAGAAGGACGTACTCGAAACCTTCACCGTGAAGTCCTGTCCTGATGCCATCAAAGA
GGTCTTCGACAATAAATTCCACATCATCGGCGCAGTGGGCATCGGCATTGCCGTGGTCATGATATTTGGC
ATGATCTTCAGTATGATCTTGTGCTGTGCTATCCGCAGGAACCGCGAGATGGTC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC202000 protein sequence
Red=Cloning site Green=Tags(s)

MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALM
MLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQR
ETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFG
MIFSMILCCAIRRNREMV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NM_001769
ORF Size 684 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001769.4
RefSeq Size 1321 bp
RefSeq ORF 687 bp
Locus ID 928
UniProt ID P21926
Cytogenetics 12p13.31
Domains transmembrane4
Protein Families Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Hematopoietic cell lineage
MW 25.4 kDa
Summary This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis. provided by RefSeq, Jan 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001769" in other vectors (7)
SKU Description Size Price
RC202000L1 Lenti ORF clone of Human CD9 molecule (CD9), Myc-DDK-tagged 10 ug
$600.00
RC202000L2 Lenti ORF clone of Human CD9 molecule (CD9), mGFP tagged 10 ug
$600.00
RC202000L3 Lenti ORF clone of Human CD9 molecule (CD9), Myc-DDK-tagged 10 ug
$600.00
RC202000L4 Lenti ORF clone of Human CD9 molecule (CD9), mGFP tagged 10 ug
$600.00
RG202000 CD9 (tGFP-tagged) - Human CD9 molecule (CD9) 10 ug
$489.00 $500.00
SC119043 CD9 (untagged)-Human CD9 molecule (CD9) 10 ug
$300.00
SC322329 CD9 (untagged)-Human CD9 molecule (CD9) 10 ug
$300.00

file-alt Citations

IgM anti-ACE2 autoantibodies in severe COVID-19 activate complement and perturb vascular endothelial function
Casciola-Rosen, Thiemann, Andrade et al
JCI Insight (2022) 7 (9) DOI: 10.1172/jci.insight.158362
Cited by 91
AI Summary: In this study, OriGene’s full-length FLAG-tagged CD9 (RC202000) and TMPRSS2 (RC208677) cDNA constructs were used to transiently transfect HEK293T cells for immunoblot assays to detect antibodies against these proteins, aiding in the investigation of autoantibody responses in severe COVID-19.
Snippet: … Immunoblots of transfected lysates to detect antibodies against CD9, CD81, and TMPRSS2. Complementary DNAs encoding full-length FLAG-tagged CD9 and TMPRSS2 (OriGene RC202000 and RC208677, respectively) and CD81 (GenScript OHu19408) were sequence verified. These DNAs were transiently transfected into HEK293T cells (purchased from ATCC) with ExpiFectamin_29;Complementary DNAs encoding full-length FLAG-tagged CD9 and TMPRSS2 (OriGene RC202000 and RC208677, respectively) and CD81 (GenScript OHu19408) were sequence verified. …
FigureFigureFigure
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products