OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HEBP1 (NM_015987) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201873
HEBP1 (Myc-DDK-tagged)-Human heme binding protein 1 (HEBP1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA368478 HEBP1 rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "HEBP1 or NM_015987"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HEBP1
Synonyms HBP; HEBP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201873 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGGGCATGATCAAGAACTCGCTGTTCGGAAGCGTAGAGACGTGGCCTTGGCAGGTCCTAAGCAAAG
GGGACAAGGAAGAAGTTGCCTATGAAGAAAGGGCCTGTGAAGGCGGCAAATTTGCCACAGTAGAAGTGAC
AGATAAGCCTGTGGATGAGGCTCTACGGGAAGCAATGCCCAAGGTCGCAAAGTATGCGGGGGGCACCAAT
GACAAGGGAATTGGGATGGGGATGACAGTCCCTATTTCCTTTGCTGTGTTCCCCAATGAAGATGGCTCTC
TGCAGAAGAAATTAAAAGTCTGGTTCCGGATTCCAAACCAATTTCAAAGCGACCCACCAGCTCCCAGTGA
CAAAAGCGTTAAGATTGAGGAACGGGAAGGCATCACTGTCTATTCCATGCAGTTTGGTGGTTATGCCAAG
GAAGCAGACTACGTAGCACAAGCCACCCGTCTGCGTGCTGCCCTGGAGGGCACAGCCACCTACCGGGGGG
ACATCTACTTCTGCACGGGTTATGACCCTCCCATGAAGCCCTACGGACGGCGCAATGAGATCTGGCTGTT
GAAGACA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201873 protein sequence
Red=Cloning site Green=Tags(s)

MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTN
DKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAK
EADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_015987
ORF Size 567 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_015987.5
RefSeq Size 1221 bp
RefSeq ORF 570 bp
Locus ID 50865
UniProt ID Q9NRV9
Cytogenetics 12p13.1
Domains SOUL
MW 21.1 kDa
Summary The full-length protein encoded by this gene is an intracellular tetrapyrrole-binding protein. This protein includes a natural chemoattractant peptide of 21 amino acids at the N-terminus, which is a natural ligand for formyl peptide receptor-like receptor 2 (FPRL2) and promotes calcium mobilization and chemotaxis in monocytes and dendritic cells. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_015987" in other vectors (6)
SKU Description Size Price
RC201873L1 Lenti ORF clone of Human heme binding protein 1 (HEBP1), Myc-DDK-tagged 10 ug
$600.00
RC201873L2 Lenti ORF clone of Human heme binding protein 1 (HEBP1), mGFP tagged 10 ug
$600.00
RC201873L3 Lenti ORF clone of Human heme binding protein 1 (HEBP1), Myc-DDK-tagged 10 ug
$600.00
RC201873L4 Lenti ORF clone of Human heme binding protein 1 (HEBP1), mGFP tagged 10 ug
$600.00
RG201873 HEBP1 (tGFP-tagged) - Human heme binding protein 1 (HEBP1) 10 ug
$489.00 $500.00
SC114563 HEBP1 (untagged)-Human heme binding protein 1 (HEBP1) 10 ug
$300.00

Plasmid Map for RC201873

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201873
Circular map for RC201873

file-alt Citations

Increased expression of heme-binding protein 1 early in Alzheimer's disease is linked to neurotoxicity
Yagensky, Kohansal-Nodehi, Gunaseelan et al
Elife (2019) 8 DOI: 10.7554/eLife.47498
AI Summary: OriGene's HEBP1 complete CDS clone (Cat#: RC201873) was used in this study to investigate the role of heme-binding protein 1 in Alzheimer's disease progression.
Snippet: Go to: MATERIALS AND METHODS KEY RESOURCES TABLE Reagent type (species) or resource DESIGNATION SOURCE OR REFERENCE IDENTIFIERS Additional information Gene (_Homo-sapiens_) _HEBP1_ Origene Gene ID: 50865 Cat#: RC201873 Complete CDS sequence was used in this study Strain, strain background (_M. musculus_) 3 × Tg AD mice (B6.129._Thy_ tr.tg-/-) PMID:12895417 [https:
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products