OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IGF2 (NM_001007139) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201849
IGF2 (Myc-DDK-tagged)-Human insulin-like growth factor 2 (somatomedin A) (IGF2), transcript variant 2
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "IGF2 or NM_001007139"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol IGF2
Synonyms C11orf43; GRDF; IGF-II; PP9974; SRS3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201849 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTCTCACCTTCTTGGCCTTCGCCTCGTGCTGCATTG
CTGCTTACCGCCCCAGTGAGACCCTGTGCGGCGGGGAGCTGGTGGACACCCTCCAGTTCGTCTGTGGGGA
CCGCGGCTTCTACTTCAGCAGGCCCGCAAGCCGTGTGAGCCGTCGCAGCCGTGGCATCGTTGAGGAGTGC
TGTTTCCGCAGCTGTGACCTGGCCCTCCTGGAGACGTACTGTGCTACCCCCGCCAAGTCCGAGAGGGACG
TGTCGACCCCTCCGACCGTGCTTCCGGACAACTTCCCCAGATACCCCGTGGGCAAGTTCTTCCAATATGA
CACCTGGAAGCAGTCCACCCAGCGCCTGCGCAGGGGCCTGCCTGCCCTCCTGCGTGCCCGCCGGGGTCAC
GTGCTCGCCAAGGAGCTCGAGGCGTTCAGGGAGGCCAAACGTCACCGTCCCCTGATTGCTCTACCCACCC
AAGACCCCGCCCACGGGGGCGCCCCCCCAGAGATGGCCAGCAATCGGAAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201849 protein sequence
Red=Cloning site Green=Tags(s)

MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEEC
CFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRLRRGLPALLRARRGH
VLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001007139
ORF Size 540 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001007139.5, NP_001007140.2
RefSeq Size 5162 bp
RefSeq ORF 543 bp
Locus ID 3481
UniProt ID P01344
Cytogenetics 11p15.5
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
MW 20.1 kDa
Summary This gene encodes a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5' region overlaps the INS gene and the 3' region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Oct 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001007139" in other vectors (7)
SKU Description Size Price
RC201849L1 Lenti ORF clone of Human insulin-like growth factor 2 (somatomedin A) (IGF2), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC201849L2 Lenti ORF clone of Human insulin-like growth factor 2 (somatomedin A) (IGF2), transcript variant 2, mGFP tagged 10 ug
$600.00
RC201849L3 Lenti ORF clone of Human insulin-like growth factor 2 (somatomedin A) (IGF2), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC201849L4 Lenti ORF clone of Human insulin-like growth factor 2 (somatomedin A) (IGF2), transcript variant 2, mGFP tagged 10 ug
$600.00
RG201849 IGF2 (tGFP-tagged) - Human insulin-like growth factor 2 (somatomedin A) (IGF2), transcript variant 2 10 ug
$489.00 $500.00
SC317276 IGF2 (untagged)-Human insulin-like growth factor 2 (somatomedin A) (IGF2), transcript variant 2 10 ug
$330.00
SC320234 IGF2 (untagged)-Human insulin-like growth factor 2 (somatomedin A) (IGF2), transcript variant 2 10 ug
$300.00

Plasmid Map for RC201849

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201849
Circular map for RC201849

file-alt Citations

Insulin Receptor Isoform A Modulates Metabolic Reprogramming of Breast Cancer Cells in Response to IGF2 and Insulin Stimulation
Vella, Nicolosi, Giuliano et al
Cells (2019) 8 (9) DOI: 10.3390/cells8091017
AI Summary: OriGene contributed to this study by providing the pCMV6-Entry empty vector and the human insulin like growth factor 2 (IGF2 Myc-DDK Tag) cDNA constructs, which were used to generate breast cancer cell models for investigating metabolic reprogramming.
Snippet: Constructs encoding either an empty vector (pCMV6-Entry with C-terminal Myc-DDK Tag), or the human insulin like growth factor 2 (IGF2 Myc-DDK Tag) cDNAs were purchased from OriGene (Rockville, MD, USA). 2.2. Cell Cultures;;Constructs encoding either an empty vector (pCMV6-Entry with C-terminal Myc-DDK Tag), or the human insulin like growth factor 2 (IGF2 Myc-DDK Tag) cDNAs were purchased from OriGene (Rockville, MD, USA). 2.2. …
Gene expression of the IGF pathway family distinguishes subsets of gastrointestinal stromal tumors wild type for KIT and PDGFRA
Beadling, Patterson, Justusson et al
Cancer Med (2013) 2 (1), 21-31 DOI: 10.1002/cam4.57
Cited by 30
AI Summary: OriGene products, specifically the IGF1R (NM_000875), IGF1 (NM_000618), IGF2 (NM_000612), and INSR (NM_000208) qPCR primer sets, were used to measure gene expression levels of key IGF pathway members in gastrointestinal stromal tumor samples, enabling the identification of distinct wild-type GIST subtypes based on their molecular profiles.
FigureFigureFigure
Gene expression of the IGF pathway family distinguishes subsets of gastrointestinal stromal tumors wild type for KIT and PDGFRA
Beadling, Patterson, Justusson
CANCER MEDICINE (2013) 2, 21 DOI: 10.1002/cam4.57
Cited by 30
AI Summary: OriGene products contributed to the study by providing commercial plasmids—specifically clones of IGF1 (RG215257), IGF2 (RC201849), INSR (RG215257), and IRS1—which were used to investigate gene expression in gastrointestinal stromal tumors.
Snippet: Additional targets were detected using commercial TaqMan Gene Expression assays (Applied Biosystems by Life Technologies): IGF1R (64-bp ... Commercial plasmids (OriGene, Rockville, MD) included clones of IGF1 (RG215257), IGF2 (RC201849), INSR (RG215257), IRS1
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products