IGF2 (NM_001007139) Human Tagged ORF Clone

SKU
RG201849
IGF2 (tGFP-tagged) - Human insulin-like growth factor 2 (somatomedin A) (IGF2), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol IGF2
Synonyms C11orf43; GRDF; IGF-II; PP9974; SRS3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201849 representing NM_001007139
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAATCCCAATGGGGAAGTCGATGCTGGTGCTTCTCACCTTCTTGGCCTTCGCCTCGTGCTGCATTG
CTGCTTACCGCCCCAGTGAGACCCTGTGCGGCGGGGAGCTGGTGGACACCCTCCAGTTCGTCTGTGGGGA
CCGCGGCTTCTACTTCAGCAGGCCCGCAAGCCGTGTGAGCCGTCGCAGCCGTGGCATCGTTGAGGAGTGC
TGTTTCCGCAGCTGTGACCTGGCCCTCCTGGAGACGTACTGTGCTACCCCCGCCAAGTCCGAGAGGGACG
TGTCGACCCCTCCGACCGTGCTTCCGGACAACTTCCCCAGATACCCCGTGGGCAAGTTCTTCCAATATGA
CACCTGGAAGCAGTCCACCCAGCGCCTGCGCAGGGGCCTGCCTGCCCTCCTGCGTGCCCGCCGGGGTCAC
GTGCTCGCCAAGGAGCTCGAGGCGTTCAGGGAGGCCAAACGTCACCGTCCCCTGATTGCTCTACCCACCC
AAGACCCCGCCCACGGGGGCGCCCCCCCAGAGATGGCCAGCAATCGGAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201849 representing NM_001007139
Red=Cloning site Green=Tags(s)

MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEEC
CFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRLRRGLPALLRARRGH
VLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001007139
ORF Size 540 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001007139.5, NP_001007140.2
RefSeq Size 5139 bp
RefSeq ORF 543 bp
Locus ID 3481
UniProt ID P01344
Cytogenetics 11p15.5
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
Summary This gene encodes a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5' region overlaps the INS gene and the 3' region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2010]
Write Your Own Review
You're reviewing:IGF2 (NM_001007139) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201849 IGF2 (Myc-DDK-tagged)-Human insulin-like growth factor 2 (somatomedin A) (IGF2), transcript variant 2 10 ug
$300.00
RC201849L1 Lenti ORF clone of Human insulin-like growth factor 2 (somatomedin A) (IGF2), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC201849L2 Lenti ORF clone of Human insulin-like growth factor 2 (somatomedin A) (IGF2), transcript variant 2, mGFP tagged 10 ug
$600.00
RC201849L3 Lenti ORF clone of Human insulin-like growth factor 2 (somatomedin A) (IGF2), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC201849L4 Lenti ORF clone of Human insulin-like growth factor 2 (somatomedin A) (IGF2), transcript variant 2, mGFP tagged 10 ug
$600.00
SC317276 IGF2 (untagged)-Human insulin-like growth factor 2 (somatomedin A) (IGF2), transcript variant 2 10 ug
$330.00
SC320234 IGF2 (untagged)-Human insulin-like growth factor 2 (somatomedin A) (IGF2), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.