OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

WDR41 (NM_018268) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC201693
WDR41 (Myc-DDK-tagged)-Human WD repeat domain 41 (WDR41)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
$289.00 $686.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA365146 WDR41 rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "WDR41 or NM_018268"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol WDR41
Synonyms MSTP048
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201693 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGCGATGGCTGATCGGGGGAGGCCGAGAACCGCAGGGACTGGCCGAGAAATCTCCTTTACAGACAA
TAGGTGAAGAACAAACCCAGAATCCCTACACTGAACTGCTAGTACTGAAGGCTCATCATGATATTGTACG
ATTTCTGGTACAGTTAGATGACTACAGATTTGCATCTGCTGGTGATGATGGAATTGTAGTTGTGTGGAAT
GCCCAGACAGGGGAAAAACTTTTAGAACTGAATGGACACACTCAAAAGATAACAGCTATTATTACATTTC
CTTCCTTGGAATCTTGTGAAGAGAAAAATCAACTCATCTTGACAGCCTCTGCTGATAGAACAGTTATTGT
GTGGGATGGTGATACTACCAGACAAGTTCAGAGAATATCATGCTTCCAGTCTACTGTAAAGTGTTTAACT
GTTCTTCAGAGACTAGATGTTTGGCTTTCTGGTGGGAATGACCTGTGTGTGTGGAACCGAAAATTAGATC
TCCTGTGTAAGACTAGCCACCTTTCTGATACAGGTATTAGTGCTTTGGTTGAAATACCTAAGAACTGTGT
TGTGGCAGCAGTTGGCAAAGAACTGATAATTTTCAGGTTGGTAGCACCCACAGAAGGATCACTAGAATGG
GATATTCTTGAAGTTAAGCGCCTCCTTGATCACCAGGATAATATTCTCTCATTGATTAATGTCAATGATT
TGAGTTTTGTCACCGGCTCCCACGTCGGAGAGCTGATCATCTGGGATGCCCTGGACTGGACCATGCAGGC
CTATGAACGCAACTTCTGGGACCCATCTCCACAACTGGACACCCAACAAGAAATAAAACTCTGTCAAAAA
TCAAATGACATTTCTATTCATCATTTCACATGTGATGAAGAGAATGTATTTGCTGCAGTTGGAAGGGGTT
TATACGTGTATAGCCTTCAAATGAAGCGTGTGATTGCCTGCCAGAAAACTGCACATGACTCCAATGTCCT
GCACGTTGCCAGACTTCCAAACAGGCAGTTAATCTCATGCTCAGAAGATGGCAGTGTACGCATTTGGGAG
TTAAGAGAAAAACAGCAGCTTGCAGCTGAGCCTGTACCAACAGGTTTTTTTAACATGTGGGGATTTGGAA
GAGTCAGCAAACAAGCCAGCCAACCTGTTAAAAAGCAGCAAGAAAATGCTACTTCATGTTCACTGGAGCT
TATTGGAGATTTGATTGGACACTCATCATCTGTGGAGATGTTTCTATACTTTGAAGATCATGGACTAGTG
ACGTGCTCCGCTGATCATCTCATTATTTTGTGGAAAAATGGAGAGCGAGAATCTGGATTGCGCAGTTTAA
GATTATTTCAAAAATTAGAGGAGAATGGTGACTTATACCTTGCTGTC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201693 protein sequence
Red=Cloning site Green=Tags(s)

MLRWLIGGGREPQGLAEKSPLQTIGEEQTQNPYTELLVLKAHHDIVRFLVQLDDYRFASAGDDGIVVVWN
AQTGEKLLELNGHTQKITAIITFPSLESCEEKNQLILTASADRTVIVWDGDTTRQVQRISCFQSTVKCLT
VLQRLDVWLSGGNDLCVWNRKLDLLCKTSHLSDTGISALVEIPKNCVVAAVGKELIIFRLVAPTEGSLEW
DILEVKRLLDHQDNILSLINVNDLSFVTGSHVGELIIWDALDWTMQAYERNFWDPSPQLDTQQEIKLCQK
SNDISIHHFTCDEENVFAAVGRGLYVYSLQMKRVIACQKTAHDSNVLHVARLPNRQLISCSEDGSVRIWE
LREKQQLAAEPVPTGFFNMWGFGRVSKQASQPVKKQQENATSCSLELIGDLIGHSSSVEMFLYFEDHGLV
TCSADHLIILWKNGERESGLRSLRLFQKLEENGDLYLAV

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_018268
ORF Size 1377 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018268.4
RefSeq Size 2608 bp
RefSeq ORF 1380 bp
Locus ID 55255
UniProt ID Q9HAD4
Cytogenetics 5q13.3-q14.1
Domains WD40
MW 51.7 kDa
Summary Non-catalytic component of the C9orf72-SMCR8 complex, a complex that has guanine nucleotide exchange factor (GEF) activity and regulates autophagy (PubMed:27193190, PubMed:27103069, PubMed:27617292, PubMed:28195531). The C9orf72-SMCR8 complex promotes the exchange of GDP to GTP, converting inactive GDP-bound RAB8A and RAB39B into their active GTP-bound form, thereby promoting autophagosome maturation (PubMed:27103069). The C9orf72-SMCR8 complex also acts as a negative regulator of autophagy initiation by interacting with the ATG1/ULK1 kinase complex and inhibiting its protein kinase activity (PubMed:27103069, PubMed:27617292).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_018268" in other vectors (7)
SKU Description Size Price
RC201693L1 Lenti-ORF clone of WDR41 (Myc-DDK-tagged)-Human WD repeat domain 41 (WDR41) 10 ug
$986.00
RC201693L2 Lenti-ORF clone of WDR41 (mGFP-tagged)-Human WD repeat domain 41 (WDR41) 10 ug
$986.00
RC201693L3 Lenti-ORF clone of WDR41 (Myc-DDK-tagged)-Human WD repeat domain 41 (WDR41) 10 ug
$986.00
RC201693L4 Lenti-ORF clone of WDR41 (mGFP-tagged)-Human WD repeat domain 41 (WDR41) 10 ug
$986.00
RG201693 WDR41 (tGFP-tagged) - Human WD repeat domain 41 (WDR41) 10 ug
$489.00 $886.00
SC108615 WDR41 (untagged)-Human WD repeat domain 41 (WDR41) 10 ug
$686.00
SC324019 WDR41 (untagged)-Human WD repeat domain 41 (WDR41) 10 ug
$686.00

Plasmid Map for RC201693

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201693
Circular map for RC201693

file-alt Citations

Loss of C9ORF72 impairs autophagy and synergizes with polyQ Ataxin-2 to induce motor neuron dysfunction and cell death
Sellier, Campanari, Julie Corbier et al
EMBO J. (2016)
Cited by 414
AI Summary: OriGene contributed to this study by providing PCMV6 plasmids containing C-terminally Flag-tagged human cDNAs for SQSTM1 (P62), OPTN, SMCR8, WDR41, ULK1, NAP1, SINTBAD, TANK, and RAB GTPases, which were used to investigate the molecular mechanisms underlying autophagy regulation in ALS-FTD.
Snippet: PCMV6 containing C-terminally Flag-tagged human cDNAs of SQSTM1 (P62), OPTN, SMCR8, WDR41, ULK1, NAP1, SINTBAD, TANK, and RAB GTPases were purchased from OriGene
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products