OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PDK4 (NM_002612) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201656
PDK4 (Myc-DDK-tagged)-Human pyruvate dehydrogenase kinase, isozyme 4 (PDK4), nuclear gene encoding mitochondrial protein
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
  $686.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA331166 Rabbit Polyclonal Anti-PDK4 Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "PDK4 or NM_002612"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PDK4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201656 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGCGGCCCGCTTCGTGCTGCGCAGCGCTGGCTCGCTCAACGGCGCCGGCCTGGTGCCCCGAGAGG
TGGAGCATTTCTCGCGCTACAGCCCGTCCCCGCTGTCCATGAAGCAGCTACTGGACTTTGGTTCAGAAAA
TGCATGTGAAAGAACTTCTTTTGCATTTTTGCGACAAGAATTGCCTGTGAGACTCGCCAACATTCTGAAG
GAAATTGATATCCTCCCGACCCAATTAGTAAATACCTCTTCAGTGCAATTGGTTAAAAGCTGGTATATAC
AGAGCCTGATGGATTTGGTGGAATTCCATGAGAAAAGCCCAGATGACCAGAAAGCATTATCAGACTTTGT
AGATACACTCATCAAAGTTCGAAATAGACACCATAATGTAGTCCCTACAATGGCACAAGGAATCATAGAG
TATAAAGATGCCTGTACAGTTGACCCAGTCACCAATCAAAATCTTCAATATTTCTTGGATCGATTTTACA
TGAACCGTATTTCTACTCGGATGCTGATGAACCAGCACATTCTTATATTTAGTGACTCACAGACAGGAAA
CCCAAGCCACATTGGAAGCATTGATCCTAACTGTGATGTGGTAGCAGTGGTCCAAGATGCCTTTGAGTGT
TCAAGGATGCTCTGTGATCAGTATTATTTATCATCTCCAGAATTAAAGCTTACACAAGTGAATGGAAAAT
TTCCAGACCAACCAATTCACATCGTGTATGTTCCTTCTCACCTCCATCATATGCTCTTTGAACTATTTAA
GAATGCAATGCGGGCAACAGTTGAACACCAGGAAAATCAGCCTTCCCTTACACCAATAGAGGTTATTGTT
GTCTTGGGAAAAGAAGACCTTACCATTAAGATTTCAGACAGAGGAGGTGGTGTTCCCCTGAGAATTATTG
ACCGCCTCTTTAGTTATACATACTCCACTGCACCAACGCCTGTGATGGATAATTCCCGGAATGCTCCTTT
GGCTGGTTTTGGTTACGGCTTGCCAATTTCTCGTCTGTATGCCAAGTACTTTCAAGGAGATCTGAATCTC
TACTCTTTATCAGGATATGGAACAGATGCTATCATCTACTTAAAGGCTTTGTCTTCTGAGTCTATAGAAA
AACTTCCAGTTTTTAACAAGTCAGCCTTCAAACATTATCAGATGAGCTCTGAGGCTGATGACTGGTGTAT
CCCAAGCAGGGAACCAAAGAACCTGGCAAAAGAAGTGGCCATG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201656 protein sequence
Red=Cloning site Green=Tags(s)

MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQLLDFGSENACERTSFAFLRQELPVRLANILK
EIDILPTQLVNTSSVQLVKSWYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIE
YKDACTVDPVTNQNLQYFLDRFYMNRISTRMLMNQHILIFSDSQTGNPSHIGSIDPNCDVVAVVQDAFEC
SRMLCDQYYLSSPELKLTQVNGKFPDQPIHIVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPIEVIV
VLGKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNL
YSLSGYGTDAIIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_002612
ORF Size 1233 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002612.2, NP_002603.1
RefSeq Size 3710 bp
RefSeq ORF 1236 bp
Locus ID 5166
UniProt ID Q16654
Cytogenetics 7q21.3
Domains HATPase_c
Protein Families Druggable Genome, Protein Kinase
MW 46.5 kDa
Summary This gene is a member of the PDK/BCKDK protein kinase family and encodes a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism. Expression of this gene is regulated by glucocorticoids, retinoic acid and insulin. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_002612" in other vectors (6)
SKU Description Size Price
RC201656L1 Lenti ORF clone of Human pyruvate dehydrogenase kinase, isozyme 4 (PDK4), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$986.00
RC201656L2 Lenti ORF clone of Human pyruvate dehydrogenase kinase, isozyme 4 (PDK4), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$986.00
RC201656L3 Lenti ORF clone of Human pyruvate dehydrogenase kinase, isozyme 4 (PDK4), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$986.00
RC201656L4 Lenti ORF clone of Human pyruvate dehydrogenase kinase, isozyme 4 (PDK4), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$986.00
RG201656 PDK4 (tGFP-tagged) - Human pyruvate dehydrogenase kinase, isozyme 4 (PDK4), nuclear gene encoding mitochondrial protein 10 ug
$886.00
SC118542 PDK4 (untagged)-Human pyruvate dehydrogenase kinase, isozyme 4 (PDK4), nuclear gene encoding mitochondrial protein 10 ug
$686.00

Plasmid Map for RC201656

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201656
Circular map for RC201656

file-alt Citations

PDK4 dictates metabolic resistance to ferroptosis by suppressing pyruvate oxidation and fatty acid synthesis
Song, Liu, Kuang et al
Cell Rep (2021) 34 (8), 108767 DOI: 10.1016/j.celrep.2021.108767
Cited by 270
AI Summary: OriGene’s Human PDK4 cDNA (RC201656) was used in this study to investigate the role of PDK4 in regulating metabolic resistance to ferroptosis in pancreatic cancer cells.
Snippet: Human PDK4 cDNA OriGene Technologies Inc. RC201656
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products