OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RPL15 (NM_002948) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201631
RPL15 (Myc-DDK-tagged)-Human ribosomal protein L15 (RPL15)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA324212 Anti-RPL15 Rabbit Polyclonal Antibody
100 ul
$305.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "RPL15 or NM_002948"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RPL15
Synonyms DBA12; EC45; L15; RPL10; RPLY10; RPYL10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201631 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTGCATACAAGTACATCCAGGAGCTATGGAGAAAGAAGCAGTCTGATGTCATGCGCTTTCTTCTGA
GGGTCCGCTGCTGGCAGTACCGCCAGCTCTCTGCTCTCCACAGGGCTCCCCGCCCCACCCGGCCTGATAA
AGCGCGCCGACTGGGCTACAAGGCCAAGCAAGGTTACGTTATATATAGGATTCGTGTTCGCCGTGGTGGC
CGAAAACGCCCAGTTCCTAAGGGTGCAACTTACGGCAAGCCTGTCCATCATGGTGTTAACCAGCTAAAGT
TTGCTCGAAGCCTTCAGTCCGTTGCAGAGGAGCGAGCTGGACGCCACTGTGGGGCTCTGAGAGTCCTGAA
TTCTTACTGGGTTGGTGAAGATTCCACATACAAATTTTTTGAGGTTATCCTCATTGATCCATTCCATAAA
GCTATCAGAAGAAATCCTGACACCCAGTGGATCACCAAACCAGTCCACAAGCACAGGGAGATGCGTGGGC
TGACATCTGCAGGCCGAAAGAGCCGTGGCCTTGGAAAGGGCCACAAGTCCCACCACACTATTGGTGGCTC
TCGCCGGGCAGCTTGGAGAAGGCGCAATACTCTCCAGCTCCACCGTTACCGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201631 protein sequence
Red=Cloning site Green=Tags(s)

MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGG
RKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFHK
AIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGLGKGHKSHHTIGGSRRAAWRRRNTLQLHRYR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_002948
ORF Size 612 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002948.5
RefSeq Size 2350 bp
RefSeq ORF 615 bp
Locus ID 6138
UniProt ID P61313, A0A024R2Q4
Cytogenetics 3p24.2
Domains Ribosomal_L15e
Protein Pathways Ribosome
MW 24.1 kDa
Summary Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of four RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L15E family of ribosomal proteins and a component of the 60S subunit. This gene shares sequence similarity with the yeast ribosomal protein YL10 gene. Elevated expression of this gene has been observed in esophageal tumors and gastric cancer tissues, and deletion of this gene has been observed in a Diamond-Blackfan anemia (DBA) patient. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. provided by RefSeq, Mar 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_002948" in other vectors (4)
SKU Description Size Price
RC201631L3 Lenti ORF clone of Human ribosomal protein L15 (RPL15), Myc-DDK-tagged 10 ug
$600.00
RC201631L4 Lenti ORF clone of Human ribosomal protein L15 (RPL15), mGFP tagged 10 ug
$600.00
RG201631 RPL15 (tGFP-tagged) - Human ribosomal protein L15 (RPL15) 10 ug
$489.00 $500.00
SC118292 RPL15 (untagged)-Human ribosomal protein L15 (RPL15) 10 ug
$300.00

Plasmid Map for RC201631

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201631
Circular map for RC201631

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products