OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GDF15 (NM_004864) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201295
GDF15 (Myc-DDK-tagged)-Human growth differentiation factor 15 (GDF15)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
  $450.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA321674 Anti-GDF15 Rabbit Polyclonal Antibody
100 ul
$305.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "GDF15 or NM_004864"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GDF15
Synonyms GDF-15; MIC-1; MIC1; NAG-1; PDF; PLAB; PTGFB
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201295 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCGGGCAAGAACTCAGGACGGTGAATGGCTCTCAGATGCTCCTGGTGTTGCTGGTGCTCTCGTGGC
TGCCGCATGGGGGCGCCCTGTCTCTGGCCGAGGCGAGCCGCGCAAGTTTCCCGGGACCCTCAGAGTTGCA
CTCCGAAGACTCCAGATTCCGAGAGTTGCGGAAACGCTACGAGGACCTGCTAACCAGGCTGCGGGCCAAC
CAGAGCTGGGAAGATTCGAACACCGACCTCGTCCCGGCCCCTGCAGTCCGGATACTCACGCCAGAAGTGC
GGCTGGGATCCGGCGGCCACCTGCACCTGCGTATCTCTCGGGCCGCCCTTCCCGAGGGGCTCCCCGAGGC
CTCCCGCCTTCACCGGGCTCTGTTCCGGCTGTCCCCGACGGCGTCAAGGTCGTGGGACGTGACACGACCG
CTGCGGCGTCAGCTCAGCCTTGCAAGACCCCAGGCGCCCGCGCTGCACCTGCGACTGTCGCCGCCGCCGT
CGCAGTCGGACCAACTGCTGGCAGAATCTTCGTCCGCACGGCCCCAGCTGGAGTTGCACTTGCGGCCGCA
AGCCGCCAGGGGGCGCCGCAGAGCGCGTGCGCGCAACGGGGACCACTGTCCGCTCGGGCCCGGGCGTTGC
TGCCGTCTGCACACGGTCCGCGCGTCGCTGGAAGACCTGGGCTGGGCCGATTGGGTGCTGTCGCCACGGG
AGGTGCAAGTGACCATGTGCATCGGCGCGTGCCCGAGCCAGTTCCGGGCGGCAAACATGCACGCGCAGAT
CAAGACGAGCCTGCACCGCCTGAAGCCCGACACGGTGCCAGCGCCCTGCTGCGTGCCCGCCAGCTACAAT
CCCATGGTGCTCATTCAAAAGACCGACACCGGGGTGTCGCTCCAGACCTATGATGACTTGTTAGCCAAAG
ACTGCCACTGCATA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201295 protein sequence
Red=Cloning site Green=Tags(s)

MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRAN
QSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRP
LRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRC
CRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYN
PMVLIQKTDTGVSLQTYDDLLAKDCHCI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_004864
ORF Size 924 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004864.4
RefSeq Size 1220 bp
RefSeq ORF 927 bp
Locus ID 9518
UniProt ID Q99988
Cytogenetics 19p13.11
Domains TGF-beta
Protein Families Druggable Genome, Secreted Protein
MW 34.1 kDa
Summary This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The protein is expressed in a broad range of cell types, acts as a pleiotropic cytokine and is involved in the stress response program of cells after cellular injury. Increased protein levels are associated with disease states such as tissue hypoxia, inflammation, acute injury and oxidative stress. provided by RefSeq, Aug 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_004864" in other vectors (6)
SKU Description Size Price
RC201295L1 Lenti ORF clone of Human growth differentiation factor 15 (GDF15), Myc-DDK-tagged 10 ug
$750.00
RC201295L2 Lenti ORF clone of Human growth differentiation factor 15 (GDF15), mGFP tagged 10 ug
$750.00
RC201295L3 Lenti ORF clone of Human growth differentiation factor 15 (GDF15), Myc-DDK-tagged 10 ug
$750.00
RC201295L4 Lenti ORF clone of Human growth differentiation factor 15 (GDF15), mGFP tagged 10 ug
$750.00
RG201295 GDF15 (tGFP-tagged) - Human growth differentiation factor 15 (GDF15) 10 ug
$489.00 $650.00
SC319494 GDF15 (untagged)-Human growth differentiation factor 15 (GDF15) 10 ug
$450.00

Plasmid Map for RC201295

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201295
Circular map for RC201295

file-alt Citations

Parental metabolic syndrome epigenetically reprograms offspring hepatic lipid metabolism in mice
De Jesus, Orime, Kaminska et al
J. Clin. Invest. (2020) 130 (5), 2391-2407 DOI: 10.1172/JCI127502
AI Summary: OriGene’s pCMV-Myc-NREP and pCMV-Myc-GDF15 plasmids were used to overexpress NREP and GDF15 in HepG2 cells, enabling the study of their roles in regulating hepatic lipid metabolism in the context of parental metabolic syndrome.
Snippet: lmitate for 24 hours. See Supplemental Table 9 for siRNA information. Plasmid transfections. HepG2 cells at 70% confluence were forward-transfected with pCMV-empty, pCMV-Myc-NREP, or pCMV-Myc-GDF15 (Origene) using Lipofectamine 3000 (Invitrogen) and Opti-MEM (Invitrogen) according to manufacturer protocols. Medium was exchanged with fresh DMEM after 8 hours of transfection, and at 48 hours cells
Growth differentiation factor 15 mediates epithelial mesenchymal transition and invasion of breast cancers through IGF-1R-FoxM1 signaling
Peake, Eze, Yang et al
Oncotarget (2017) 8 (55), 94393-94406 DOI: 10.18632/oncotarget.21765
Snippet: BT474 cells were transfected with 3 μg plasmid DNA (pCMV empty vector or pCMVmyc-GDF15, both from Origene, Rockville, MD) using Lipofectamine (Invitrogen, Carlsbad, CA) and DMSO shock
FigureFigureFigure
P38 MAPK contributes to resistance and invasiveness of HER2- overexpressing breast cancer
Donnelly, Paplomata, Peake et al
Curr. Med. Chem. (2014) 21 (4), 501-10
AI Summary: OriGene products, specifically the pCMV empty vector and pCMV myc-GDF15 plasmids, were used to generate stable GDF15-overexpressing cell clones, enabling the study of GDF15’s role in p38 MAPK activation and trastuzumab resistance in HER2-overexpressing breast cancer.
Snippet: GDF15 stable clones were created by transfecting BT474 cells with 3 g of pCMV empty vector or pCMV myc-GDF15, both from Origene (Rockville, MD), using Lipofectamine (Invitrogen, Carlsbad, CA) combined with DMSO shock and selecting cells in 200 g/mL G418 ... Related articles All 3 versions Cite SaveSaving
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products