OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

APE1 (APEX1) (NM_080648) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201208
APEX1 (Myc-DDK-tagged)-Human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 2
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA800334 APEX1 mouse monoclonal antibody, clone OTI6E10 (formerly 6E10) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "APE1 or NM_080648"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol APE1
Synonyms APE; APE1; APEN; APEX; APX; HAP1; REF1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201208 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGAAGCGTGGGAAAAAGGGAGCGGTGGCGGAAGACGGGGATGAGCTCAGGACAGAGCCAGAGGCCA
AGAAGAGTAAGACGGCCGCAAAGAAAAATGACAAAGAGGCAGCAGGAGAGGGCCCAGCCCTGTATGAGGA
CCCCCCAGATCAGAAAACCTCACCCAGTGGCAAACCTGCCACACTCAAGATCTGCTCTTGGAATGTGGAT
GGGCTTCGAGCCTGGATTAAGAAGAAAGGATTAGATTGGGTAAAGGAAGAAGCCCCAGATATACTGTGCC
TTCAAGAGACCAAATGTTCAGAGAACAAACTACCAGCTGAACTTCAGGAGCTGCCTGGACTCTCTCATCA
ATACTGGTCAGCTCCTTCGGACAAGGAAGGGTACAGTGGCGTGGGCCTGCTTTCCCGCCAGTGCCCACTC
AAAGTTTCTTACGGCATAGGCGATGAGGAGCATGATCAGGAAGGCCGGGTGATTGTGGCTGAATTTGACT
CGTTTGTGCTGGTAACAGCATATGTACCTAATGCAGGCCGAGGTCTGGTACGACTGGAGTACCGGCAGCG
CTGGGATGAAGCCTTTCGCAAGTTCCTGAAGGGCCTGGCTTCCCGAAAGCCCCTTGTGCTGTGTGGAGAC
CTCAATGTGGCACATGAAGAAATTGACCTTCGCAACCCCAAGGGGAACAAAAAGAATGCTGGCTTCACGC
CACAAGAGCGCCAAGGCTTCGGGGAATTACTGCAGGCTGTGCCACTGGCTGACAGCTTTAGGCACCTCTA
CCCCAACACACCCTATGCCTACACCTTTTGGACTTATATGATGAATGCTCGATCCAAGAATGTTGGTTGG
CGCCTTGATTACTTTTTGTTGTCCCACTCTCTGTTACCTGCATTGTGTGACAGCAAGATCCGTTCCAAGG
CCCTCGGCAGTGATCACTGTCCTATCACCCTATACCTAGCACTG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201208 protein sequence
Red=Cloning site Green=Tags(s)

MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVD
GLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPL
KVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGD
LNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGW
RLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_080648
ORF Size 954 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_080648.3
RefSeq Size 1497 bp
RefSeq ORF 957 bp
Locus ID 328
UniProt ID P27695
Cytogenetics 14q11.2
Domains Exo_endo_phos
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
Protein Pathways Base excision repair
MW 35.6 kDa
Summary The APEX gene encodes the major AP endonuclease in human cells. It encodes the APEX endonuclease, a DNA repair enzyme with apurinic/apyrimidinic (AP) activity. Such AP activity sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. The AP sites are the most frequent pre-mutagenic lesions that can prevent normal DNA replication. Splice variants have been found for this gene; all encode the same protein. Disruptions in the biological functions related to APEX are associated with many various malignancies and neurodegenerative diseases.provided by RefSeq, Dec 2019
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_080648" in other vectors (6)
SKU Description Size Price
RC201208L1 Lenti ORF clone of Human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC201208L2 Lenti ORF clone of Human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 2, mGFP tagged 10 ug
$600.00
RC201208L3 Lenti ORF clone of Human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC201208L4 Lenti ORF clone of Human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 2, mGFP tagged 10 ug
$600.00
RG201208 APEX1 (tGFP-tagged) - Human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 2 10 ug
$489.00 $500.00
SC319461 APEX1 (untagged)-Human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 2 10 ug
$300.00

Plasmid Map for RC201208

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201208
Circular map for RC201208

file-alt Citations

CDK1-mediated phosphorylation of APE1 drives synthetic lethality, p53-dependent metastasis, and immune sensitization in NSCLC
Wang, Li, Peng et al
Cell Death and Disease (2026)
AI Summary: In this study, the human APE1 Tagged ORF Clone (Cat. No. RC201208) from OriGene was used to investigate the regulatory interaction between CDK1 and APE1 in non-small cell lung cancer, supporting key mechanistic experiments on APE1 function and regulation.
Snippet: The human APE1 Tagged ORF Clone (Cat. No. RC201208, Accession No. NM_080648) was purchased from Origene Technologies. Plasmids pCDH-EF1-Luc2-cG-BSD (Addgene plasmid #124982), Rc/CMV-cyclin A (Addgene plasmid# 8959), and pcyclinB1-mCherry (Addgene plasmid# 26063) were obtained from Addgene. Various
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products