OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Beta Arrestin 2 (ARRB2) (NM_004313) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC201168
ARRB2 (Myc-DDK-tagged)-Human arrestin, beta 2 (ARRB2), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
$289.00 $686.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Beta Arrestin 2 or NM_004313"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Beta Arrestin 2
Synonyms ARB2; ARR2; BARR2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201168 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGGAGAAACCCGGGACCAGGGTCTTCAAGAAGTCGAGCCCTAACTGCAAGCTCACCGTGTACTTGG
GCAAGCGGGACTTCGTAGATCACCTGGACAAAGTGGACCCTGTAGATGGCGTGGTGCTTGTGGACCCTGA
CTACCTGAAGGACCGCAAAGTGTTTGTGACCCTCACCTGCGCCTTCCGCTATGGCCGTGAAGACCTGGAT
GTGCTGGGCTTGTCCTTCCGCAAAGACCTGTTCATCGCCACCTACCAGGCCTTCCCCCCGGTGCCCAACC
CACCCCGGCCCCCCACCCGCCTGCAGGACCGGCTGCTGAGGAAGCTGGGCCAGCATGCCCACCCCTTCTT
CTTCACCATACCCCAGAATCTTCCATGCTCCGTCACACTGCAGCCAGGCCCAGAGGATACAGGAAAGGCC
TGCGGCGTAGACTTTGAGATTCGAGCCTTCTGTGCTAAATCACTAGAAGAGAAAAGCCACAAAAGGAACT
CTGTGCGGCTGGTGATCCGAAAGGTGCAGTTCGCCCCGGAGAAACCCGGCCCCCAGCCTTCAGCCGAAAC
CACACGCCACTTCCTCATGTCTGACCGGTCCCTGCACCTCGAGGCTTCCCTGGACAAGGAGCTGTACTAC
CATGGGGAGCCCCTCAATGTAAATGTCCACGTCACCAACAACTCCACCAAGACCGTCAAGAAGATCAAAG
TCTCTGTGAGACAGTACGCCGACATCTGCCTCTTCAGCACCGCCCAGTACAAGTGTCCTGTGGCTCAACT
CGAACAAGATGACCAGGTATCTCCCAGCTCCACATTCTGTAAGGTGTACACCATAACCCCACTGCTCAGT
GACAACCGGGAGAAGCGGGGTCTCGCCCTGGATGGGAAACTCAAGCACGAGGACACCAACCTGGCTTCCA
GCACCATCGTGAAGGAGGGTGCCAACAAGGAGGTGCTGGGAATCCTGGTGTCCTACAGGGTCAAGGTGAA
GCTGGTGGTGTCTCGAGGCGGGGATGTCTCTGTGGAGCTGCCTTTTGTTCTTATGCACCCCAAGCCCCAC
GACCACATCCCCCTCCCCAGACCCCAGTCAGCCGCTCCGGAGACAGATGTCCCTGTGGACACCAACCTCA
TTGAATTTGATACCAACTATGCCACAGATGATGACATTGTGTTTGAGGACTTTGCCCGGCTTCGGCTGAA
GGGGATGAAGGATGACGACTATGATGATCAACTCTGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201168 protein sequence
Red=Cloning site Green=Tags(s)

MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLD
VLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKA
CGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYY
HGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLS
DNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPH
DHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_004313
ORF Size 1227 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004313.2
RefSeq Size 1936 bp
RefSeq ORF 1230 bp
Locus ID 409
UniProt ID P32121
Cytogenetics 17p13.2
Domains arrestin
Protein Families Druggable Genome
Protein Pathways Chemokine signaling pathway, Endocytosis, MAPK signaling pathway, Olfactory transduction
MW 46.1 kDa
Summary Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Mar 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_004313" in other vectors (6)
SKU Description Size Price
RC201168L1 Lenti ORF clone of Human arrestin, beta 2 (ARRB2), transcript variant 1, Myc-DDK-tagged 10 ug
$986.00
RC201168L2 Lenti ORF clone of Human arrestin, beta 2 (ARRB2), transcript variant 1, mGFP tagged 10 ug
$986.00
RC201168L3 Lenti ORF clone of Human arrestin, beta 2 (ARRB2), transcript variant 1, Myc-DDK-tagged 10 ug
$986.00
RC201168L4 Lenti ORF clone of Human arrestin, beta 2 (ARRB2), transcript variant 1, mGFP tagged 10 ug
$986.00
RG201168 ARRB2 (tGFP-tagged) - Human arrestin, beta 2 (ARRB2), transcript variant 1 10 ug
$489.00 $886.00
SC108950 ARRB2 (untagged)-Human arrestin, beta 2 (ARRB2), transcript variant 1 10 ug
$686.00

Plasmid Map for RC201168

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201168
Circular map for RC201168

file-alt Citations

Synaptamide activates the adhesion GPCR GPR110 (ADGRF1) through GAIN domain binding
Huang, Hu, Kwon et al
Commun Biol (2020) 3 (1), 109 DOI: 10.1038/s42003-020-0831-6
Cited by 44
AI Summary: OriGene contributed β-arrestin 2 (variant 1) DNA, which was used in this study to investigate the molecular mechanisms of GPR110 activation by synaptamide.
Snippet: iton X-100, DTT, and iodoacetamide were purchased from Sigma. Synaptamide, biotinylated- and bodipy-synaptamide were prepared by NIAAA/NIH or NCATS/NIH. β-arrestin 2 (variant 1) DNA was obtain from Origene. Cell culture HEK293 (American Type Culture Collection) or GloResponseTM CRE-luc2P HEK293 reporter cell line (Promega) were cultured in DMEM (Invitrogen) with 10% fetal bovine serum (FBS, Inv
FigureFigureFigure
β-Arrestins regulate stem cell-like phenotype and response to chemotherapy in bladder cancer
Kallifatidis, Smith, Morera et al
Mol. Cancer Ther. (2019)
AI Summary: OriGene products, specifically the HuSH/shRNA Plasmid Panels and the ARRB2 overexpression plasmid (RC201168), were used to manipulate ARRB2 expression in bladder cancer cells, enabling the study of β-arrestins’ roles in regulating stem cell-like properties and chemotherapy response.
Snippet: All cells were grown in RPMI 1640 containing 10% FBS. For stable down regulation of ARRB2, 253J cells were transfected with HuSH/shRNA Plasmid Panels (Origene). For over expression of ARRB2 cells were transfected with an ARRB2 plasmid (RC201168, Origene
Probing structure-activity relationship in β-arrestin2 recruitment of diversely substituted adenosine derivatives
Storme, Tosh, Gao et al
Biochem. Pharmacol. (2018) 158, 103-113 DOI: 10.1016/j.bcp.2018.10.003
AI Summary: OriGene products contributed to this study by providing the human A3AR construct (NM_000677.2) and the human β-arrestin2 (βarr2) construct (NM_004313), which were essential for generating the cell lines used to investigate β-arrestin2 recruitment by adenosine derivatives.
Snippet: Hospital, Belgium). The human A 3 AR construct (NM_000677.2, transcript variant 2 of the ADORA3 gene) and human βarr2 construct (NM_004313) were purchased from Origene Technologies (Rockville, MD, USA). DOTAP
Activity-Based Concept to Screen Biological Matrices for Opiates and (Synthetic) Opioids
Cannaert, Vasudevan, Friscia et al
Clin. Chem. (2018)
AI Summary: OriGene Technologies contributed to this study by providing the plasmid containing the human ARRB2 (NM_004313) coding sequence, which was essential for constructing the cell-based assay to detect opioid activity.
Snippet: The plasmid containing the human ARRB25 (NM 004313) coding sequence was purchased from Origene Technologies. The human OPRM1 (NM 000914) coding sequence was kindly provided by Prof. K. Van Craenenbroeck
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products