OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CDC42EP4 (NM_012121) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201162
CDC42EP4 (Myc-DDK-tagged)-Human CDC42 effector protein (Rho GTPase binding) 4 (CDC42EP4)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA334431 Rabbit Polyclonal Anti-CDC42EP4 Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "CDC42EP4 or NM_012121"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CDC42EP4
Synonyms BORG4; CEP4; KAIA1777
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201162 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAATCCTCAAGCAACTGGTGTCCAGCTCGGTGCACTCCAAGCGCCGTTCCCGAGCGGACCTCACGG
CCGAGATGATCAGCGCCCCGCTGGGCGACTTCCGCCACACCATGCACGTTGGCCGGGCCGGAGACGCCTT
TGGGGACACCTCCTTCCTCAATAGCAAGGCTGGCGAGCCCGACGGCGAGTCCTTGGACGAACAGCCCTCT
TCTTCATCTTCCAAACGCAGTCTCCTGTCCAGGAAGTTCCGGGGCAGCAAGCGGTCACAGTCGGTGACCA
GGGGGGAGCGGGAGCAGCGTGACATGCTGGGCTCCCTGCGGGACTCGGCCCTGTTTGTCAAGAATGCCAT
GTCCCTGCCCCAGCTCAATGAGAAGGAGGCCGCGGAGAAGGGCACCAGTAAGCTGCCCAAGAGCCTGTCA
TCCAGCCCCGTGAAGAAGGCCAATGACGGGGAGGGCGGCGATGAGGAGGCGGGCACGGAGGAGGCAGTGC
CCCGTCGGAATGGGGCCGCGGGTCCACATTCCCCTGACCCCCTCCTCGATGAGCAGGCCTTTGGGGATCT
GACAGATCTGCCTGTCGTGCCCAAGGCCACGTACGGGCTGAAGCATGCGGAGTCCATCATGTCCTTCCAC
ATCGACCTGGGGCCCTCCATGCTGGGTGACGTCCTCAGCATCATGGACAAGGAGGAGTGGGACCCCGAGG
AGGGGGAGGGTGGTTACCATGGCGATGAGGGCGCCGCTGGCACCATCACCCAGGCTCCCCCGTACGCCGT
GGCGGCCCCTCCCCTGGCAAGGCAGGAAGGCAAGGCTGGCCCAGACTTGCCCTCCCTCCCCTCCCATGCT
CTGGAGGATGAGGGGTGGGCAGCAGCGGCCCCCAGCCCCGGCTCAGCCCGCAGCATGGGCAGCCACACCA
CACGGGACAGCAGCTCCCTCTCCAGCTGCACCTCAGGCATCCTGGAGGAGCGCAGCCCTGCCTTCCGGGG
GCCGGACAGGGCCCGGGCTGCTGTCTCAAGACAGCCAGACAAGGAGTTCTCCTTCATGGATGAGGAGGAG
GAGGATGAAATCCGTGTG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201162 protein sequence
Red=Cloning site Green=Tags(s)

MPILKQLVSSSVHSKRRSRADLTAEMISAPLGDFRHTMHVGRAGDAFGDTSFLNSKAGEPDGESLDEQPS
SSSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQLNEKEAAEKGTSKLPKSLS
SSPVKKANDGEGGDEEAGTEEAVPRRNGAAGPHSPDPLLDEQAFGDLTDLPVVPKATYGLKHAESIMSFH
IDLGPSMLGDVLSIMDKEEWDPEEGEGGYHGDEGAAGTITQAPPYAVAAPPLARQEGKAGPDLPSLPSHA
LEDEGWAAAAPSPGSARSMGSHTTRDSSSLSSCTSGILEERSPAFRGPDRARAAVSRQPDKEFSFMDEEE
EDEIRV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_012121
ORF Size 1068 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012121.5
RefSeq Size 3121 bp
RefSeq ORF 1071 bp
Locus ID 23580
UniProt ID Q9H3Q1, B2R6D8
Cytogenetics 17q25.1
Domains PBD
MW 38 kDa
Summary The product of this gene is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. This protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, this protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_012121" in other vectors (6)
SKU Description Size Price
RC201162L1 Lenti ORF clone of Human CDC42 effector protein (Rho GTPase binding) 4 (CDC42EP4), Myc-DDK-tagged 10 ug
$757.00
RC201162L2 Lenti ORF clone of Human CDC42 effector protein (Rho GTPase binding) 4 (CDC42EP4), mGFP tagged 10 ug
$757.00
RC201162L3 Lenti ORF clone of Human CDC42 effector protein (Rho GTPase binding) 4 (CDC42EP4), Myc-DDK-tagged 10 ug
$757.00
RC201162L4 Lenti ORF clone of Human CDC42 effector protein (Rho GTPase binding) 4 (CDC42EP4), mGFP tagged 10 ug
$757.00
RG201162 CDC42EP4 (tGFP-tagged) - Human CDC42 effector protein (Rho GTPase binding) 4 (CDC42EP4) 10 ug
$657.00
SC111209 CDC42EP4 (untagged)-Human CDC42 effector protein (Rho GTPase binding) 4 (CDC42EP4) 10 ug
$457.00

Plasmid Map for RC201162

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201162
Circular map for RC201162

file-alt Citations

Phosphorylation of Cdc42 Effector Protein-4 (CEP4) by Protein Kinase C Promotes Motility of Human Breast Cells
Zhao, Rotenberg
J. Biol. Chem. (2014)
AI Summary: OriGene products contributed to this study by providing the human CEP4-pCMV6 plasmid and bicistronic TEM4-shRNA/GFP and control shRNA/GFP plasmids, which were essential for manipulating gene expression to investigate the roles of CEP4 phosphorylation and TEM4 in breast cell motility.
Snippet: 3 DMEM/F12 medium, horse serum, and DNA primers were purchased from Life Technologies (Carlsbad, CA). Human CEP4-pCMV6 and bi- cistronic TEM4-shRNA/GFP and control shRNA/GFP plasmids were obtained from Origene, Inc. (Rockville, MD). ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products