OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PSMC3IP (NM_013290) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201045
PSMC3IP (Myc-DDK-tagged)-Human PSMC3 interacting protein (PSMC3IP), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA342445 Rabbit Polyclonal Anti-PSMC3IP Antibody
100 ul
$525.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "PSMC3IP or NM_013290"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PSMC3IP
Synonyms GT198; HOP2; HUMGT198A; ODG3; TBPIP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201045 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTAAAGGCCGGGCAGAAGCTGCGGCGGGAGCCGCCGGGATCCTCCTGAGGTACCTGCAGGAGCAGA
ACCGGCCCTACAGCTCCCAGGATGTGTTCGGGAACCTACAGCGGGAACACGGACTGGGCAAGGCGGTGGT
GGTGAAGACGCTGGAGCAGCTGGCGCAACAAGGCAAGATCAAAGAGAAGATGTACGGCAAGCAGAAGATC
TATTTTGCGGATCAGGACCAGTTTGACATGGTGAGTGATGCTGACCTTCAAGTCCTAGATGGCAAAATCG
TGGCCCTCACTGCTAAGGTGCAGAGCTTGCAGCAGAGCTGCCGCTACATGGAGGCTGAGATGCAGAAAGA
AATCCAGGAGTTAAAGAAGGAATGCGCTGGCTACAGAGAGAGATTGAAGAACATTAAAGCAGCTACCAAT
CATGTGACTCCAGAAGAGAAAGAGCAGGTGTACAGAGAGAGGCAGAAGTACTGTAAGGAGTGGAGGAAGA
GGAAGAGGATGGCTACAGAGCTGTCTGATGCAATACTTGAAGGATACCCCAAGAGCAAGAAGCAGTTCTT
TGAGGAAGTTGGGATAGAGACGGATGAAGATTACAACGTCACACTCCCAGACCCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201045 protein sequence
Red=Cloning site Green=Tags(s)

MSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVVVKTLEQLAQQGKIKEKMYGKQKI
YFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAEMQKEIQELKKECAGYRERLKNIKAATN
HVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIETDEDYNVTLPDP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_013290
ORF Size 615 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_013290.6, NP_037422.2
RefSeq Size 1440 bp
RefSeq ORF 618 bp
Locus ID 29893
UniProt ID Q9P2W1
Cytogenetics 17q21.2
Protein Families Druggable Genome
MW 23.6 kDa
Summary This gene encodes a protein that functions in meiotic recombination. It is a subunit of the PSMC3IP/MND1 complex, which interacts with PSMC3/TBP1 to stimulate DMC1- and RAD51-mediated strand exchange during meiosis. The protein encoded by this gene can also co-activate ligand-driven transcription mediated by estrogen, androgen, glucocorticoid, progesterone, and thyroid nuclear receptors. Mutations in this gene cause XX female gonadal dysgenesis. Alternative splicing of this gene results in multiple transcript variants. provided by RefSeq, Dec 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_013290" in other vectors (4)
SKU Description Size Price
RC201045L3 Lenti ORF clone of Human PSMC3 interacting protein (PSMC3IP), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC201045L4 Lenti ORF clone of Human PSMC3 interacting protein (PSMC3IP), transcript variant 1, mGFP tagged 10 ug
$600.00
RG201045 PSMC3IP (tGFP-tagged) - Human PSMC3 interacting protein (PSMC3IP), transcript variant 1 10 ug
$500.00
SC309418 PSMC3IP (untagged)-Human PSMC3 interacting protein (PSMC3IP), transcript variant 1 10 ug
$330.00

Plasmid Map for RC201045

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201045
Circular map for RC201045

file-alt Citations

GDF15 inhibits early-stage adipocyte differentiation by enhancing HOP2 expression and suppressing C/EBPα expression
Kim, Kang, Kim et al
Mol Cell Endocrinol (2025) 598, 112461 DOI: 10.1016/j.mce.2025.112461
Cited by 9
AI Summary: OriGene products, specifically the PSMC3IP (HOP2: RC201045; Myc-DDK-tagged) and GDF15 (RG201295; tGFP-tagged) plasmids, were used in this study to overexpress HOP2 and GDF15 in cells, enabling the investigation of their roles in adipocyte differentiation.
Snippet: … The following plasmids were purchased from OriGene (Rockville, MD, USA): PSMC3IP (HOP2: RC201045;Myc-DDK-tagged) and GDF15 (RG201295;tGFP-tagged). …
GDF15 inhibits early-stage adipocyte differentiation by enhancing HOP2 expression and suppressing C/EBPα expression
Kim, Kang, Kim et al
Research Square (2024)
Snippet: NTERFERENCE Transient transfection was carried out using Lipofectamine 2000 reagent (11668019;Thermo Fisher) following the manufacturer's guidelines. The following plasmids were purchased from OriGene (Rockville, MD, USA): PSMC3IP (HOP2;RC201045;Myc-DDK-tagged) and GDF15 (RG201295;tGFP-tagged). For RNA interference, the cells were transfected with 100 pmol siRNA using Lipofectamine RNA
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products