OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PSMC2 (NM_002803) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC200945
PSMC2 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) 26S subunit, ATPase, 2 (PSMC2), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA350186 Rabbit Polyclonal Anti-PSMC2 Antibody
100 ul
$205.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "PSMC2 or NM_002803"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PSMC2
Synonyms MSS1; Nbla10058; RPT1; S7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200945 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGATTACCTCGGTGCCGATCAGCGGAAGACCAAAGAGGATGAGAAGGACGACAAGCCCATCCGAG
CTCTGGATGAGGGGGATATTGCCTTGTTGAAAACTTATGGTCAGAGCACTTACTCTAGGCAGATCAAGCA
AGTTGAAGATGACATTCAGCAACTTCTCAAGAAAATTAATGAGCTCACTGGTATTAAAGAATCTGACACT
GGCCTGGCCCCACCAGCACTCTGGGATTTGGCTGCAGATAAGCAGACACTCCAGAGTGAACAGCCTTTAC
AGGTTGCCAGGTGTACAAAGATAATCAATGCTGATTCGGAGGACCCAAAATACATTATCAACGTAAAGCA
GTTTGCCAAGTTTGTGGTGGACCTTAGTGATCAGGTGGCACCTACTGACATTGAAGAAGGGATGAGAGTG
GGCGTGGATAGAAATAAATATCAAATTCACATTCCATTGCCTCCTAAGATTGACCCAACAGTTACCATGA
TGCAGGTGGAAGAGAAACCTGATGTCACATACAGTGATGTTGGTGGCTGTAAGGAACAGATTGAGAAACT
GCGAGAAGTAGTTGAAACCCCATTACTTCATCCAGAGAGGTTTGTGAACCTTGGCATTGAGCCTCCCAAG
GGCGTGCTGCTCTTTGGTCCACCCGGTACAGGCAAGACACTCTGTGCGCGGGCAGTTGCTAATCGGACTG
ATGCGTGCTTCATTCGAGTTATTGGATCTGAGCTTGTACAGAAATACGTCGGTGAGGGGGCTCGAATGGT
TCGTGAACTCTTTGAAATGGCCAGAACAAAAAAAGCCTGCCTTATCTTCTTTGATGAAATTGATGCTATT
GGAGGGGCTCGTTTTGATGATGGTGCTGGAGGTGACAATGAAGTGCAGAGAACAATGTTGGAACTGATCA
ATCAGCTTGATGGTTTTGATCCTCGAGGCAATATTAAAGTGCTGATGGCCACTAACAGACCTGATACTTT
GGATCCAGCACTGATGAGGCCAGGGAGATTGGATAGAAAAATTGAATTTAGCTTGCCCGATCTAGAGGGT
CGGACCCACATATTTAAGATTCACGCTCGTTCAATGAGTGTTGAAAGAGATATCAGATTTGAACTGTTAG
CACGACTGTGTCCAAATAGCACTGGTGCTGAGATTAGAAGCGTCTGCACAGAGGCTGGTATGTTTGCCAT
CAGAGCACGGCGAAAAATTGCTACCGAGAAGGATTTCTTGGAAGCTGTAAATAAGGTCATTAAGTCTTAT
GCCAAATTCAGTGCTACTCCTCGTTACATGACATACAAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC200945 protein sequence
Red=Cloning site Green=Tags(s)

MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDT
GLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRV
GVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPK
GVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAI
GGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEG
RTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSY
AKFSATPRYMTYN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_002803
ORF Size 1299 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002803.3
RefSeq Size 2846 bp
RefSeq ORF 1302 bp
Locus ID 5701
UniProt ID P35998, A0A140VK70
Cytogenetics 7q22.1
Domains AAA
Protein Pathways Proteasome
MW 48.6 kDa
Summary The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. This subunit has been shown to interact with several of the basal transcription factors so, in addition to participation in proteasome functions, this subunit may participate in the regulation of transcription. This subunit may also compete with PSMC3 for binding to the HIV tat protein to regulate the interaction between the viral protein and the transcription complex. Alternative splicing results in multiple transcript variants encoding distinct isoforms. provided by RefSeq, Mar 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_002803" in other vectors (6)
SKU Description Size Price
RC200945L1 Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 2 (PSMC2), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC200945L2 Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 2 (PSMC2), transcript variant 1, mGFP tagged 10 ug
$757.00
RC200945L3 Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 2 (PSMC2), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC200945L4 Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 2 (PSMC2), transcript variant 1, mGFP tagged 10 ug
$757.00
RG200945 PSMC2 (tGFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 2 (PSMC2), transcript variant 1 10 ug
$489.00 $657.00
SC321353 PSMC2 (untagged)-Human proteasome (prosome, macropain) 26S subunit, ATPase, 2 (PSMC2), transcript variant 1 10 ug
$457.00

Plasmid Map for RC200945

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC200945
Circular map for RC200945

file-alt Citations

The autism-linked UBE3A T485A mutant E3 ubiquitin ligase activates the Wnt/β-catenin pathway by inhibiting the proteasome
Yi, Paranjape, Walker et al
J. Biol. Chem. (2017) 292 (30), 12503-12515 DOI: 10.1074/jbc.M117.788448
AI Summary: OriGene products, specifically the pCMV6 Myc-DDK-tagged constructs for PSMB1, PSMC2, PSMC5, PSMC6, PSMD1, PSMD2, PSMD3, PSMD6, PSMD7, PSMD11, and untagged PSMD4, were used to overexpress proteasome subunits and investigate their role in reversing the effects of the autism-linked UBE3A T485A mutant on Wnt/β-catenin signaling.
Snippet: UbG76V-GFP was obtained from Addgene (23969). pCMV6 Myc-DDK-tagged constructs for PSMB1 (RC201798), PSMC2 (RC200945), PSMC5 (RC201251), PSMC6 (RC202809), PSMD1 (RC210486), PSMD2 (RC203204), PSMD3 (RC202307), PSMD6 (RC202292), PSMD7 (RC203133), PSMD11 (RC201201), and untagged PSMD4 (SC111678) were all purchased from Origene
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products