OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GNAT2 (NM_005272) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC200685
GNAT2 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 (GNAT2)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA308890 Rabbit Polyclonal antibody to GNAT2 (guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2)
100 ul
$665.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "GNAT2 or NM_005272"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GNAT2
Synonyms ACHM4; GNATC
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200685 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAAGTGGAGCCAGTGCTGAGGACAAAGAACTGGCCAAGAGGTCCAAGGAGCTAGAAAAGAAGCTGC
AGGAGGATGCTGATAAGGAAGCCAAGACTGTCAAGCTGCTACTGCTGGGTGCTGGGGAGTCAGGAAAGAG
CACCATCGTCAAACAGATGAAGATCATTCACCAGGATGGCTATTCACCAGAAGAATGCCTGGAGTTCAAG
GCTATCATCTATGGAAATGTGCTGCAGTCCATCCTGGCTATCATCCGGGCCATGACCACACTGGGCATCG
ATTATGCTGAACCAAGCTGTGCGGATGACGGGCGACAGCTCAACAACCTGGCTGACTCCATTGAGGAGGG
AACCATGCCTCCTGAGCTCGTGGAGGTCATTAGGAGGTTGTGGAAGGATGGTGGGGTGCAAGCCTGCTTC
GAGAGAGCTGCAGAATACCAGCTTAATGACTCCGCATCTTACTACCTGAACCAATTAGAACGAATTACAG
ACCCTGAGTACCTCCCTAGTGAGCAAGATGTGCTCCGATCCAGAGTCAAAACCACAGGCATCATTGAAAC
CAAGTTTTCCGTCAAAGACTTGAATTTCAGGATGTTTGATGTGGGAGGGCAGAGATCCGAGAGAAAGAAG
TGGATCCACTGCTTCGAGGGAGTCACCTGCATCATTTTCTGTGCAGCCCTCAGTGCCTATGATATGGTGC
TGGTGGAAGATGACGAAGTGAATCGTATGCATGAGTCTTTGCATCTGTTCAACAGCATATGTAACCACAA
ATTCTTTGCGGCTACTTCCATTGTCCTCTTTCTCAACAAGAAGGACCTCTTTGAGGAAAAAATCAAGAAA
GTCCATCTCAGCATTTGTTTTCCAGAGTATGATGGTAACAACTCCTATGATGATGCGGGGAATTACATAA
AGAGCCAGTTCCTTGACCTCAATATGCGAAAAGATGTCAAAGAAATCTACAGTCACATGACCTGTGCTAC
AGATACACAGAATGTCAAATTTGTGTTTGATGCAGTTACAGATATTATCATCAAAGAAAACCTCAAGGAC
TGCGGCCTCTTC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC200685 protein sequence
Red=Cloning site Green=Tags(s)

MGSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEFK
AIIYGNVLQSILAIIRAMTTLGIDYAEPSCADDGRQLNNLADSIEEGTMPPELVEVIRRLWKDGGVQACF
ERAAEYQLNDSASYYLNQLERITDPEYLPSEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKK
WIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKK
VHLSICFPEYDGNNSYDDAGNYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKD
CGLF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_005272
ORF Size 1062 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005272.1
RefSeq Size 1384 bp
RefSeq ORF 1065 bp
Locus ID 2780
UniProt ID P19087, Q5T697
Cytogenetics 1p13.3
Protein Families Druggable Genome
MW 40.2 kDa
Summary Transducin is a 3-subunit guanine nucleotide-binding protein (G protein) which stimulates the coupling of rhodopsin and cGMP-phoshodiesterase during visual impulses. The transducin alpha subunits in rods and cones are encoded by separate genes. This gene encodes the alpha subunit in cones. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_005272" in other vectors (6)
SKU Description Size Price
RC200685L1 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 (GNAT2), Myc-DDK-tagged 10 ug
$757.00
RC200685L2 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 (GNAT2), mGFP tagged 10 ug
$757.00
RC200685L3 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 (GNAT2), Myc-DDK-tagged 10 ug
$757.00
RC200685L4 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 (GNAT2), mGFP tagged 10 ug
$757.00
RG200685 GNAT2 (tGFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 (GNAT2) 10 ug
$489.00 $657.00
SC122705 GNAT2 (untagged)-Human guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 (GNAT2) 10 ug
$457.00

Plasmid Map for RC200685

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC200685
Circular map for RC200685

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products