OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HDAC3 (NM_003883) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC200605
HDAC3 (Myc-DDK-tagged)-Human histone deacetylase 3 (HDAC3)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
2 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA806191 HDAC3 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "HDAC3 or NM_003883"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HDAC3
Synonyms HD3; KDAC3; RPD3; RPD3-2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200605 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAAGACCGTGGCCTATTTCTACGACCCCGACGTGGGCAACTTCCACTACGGAGCTGGACACCCTA
TGAAGCCCCATCGCCTGGCATTGACCCATAGCCTGGTCCTGCATTACGGTCTCTATAAGAAGATGATCGT
CTTCAAGCCATACCAGGCCTCCCAGCATGACATGTGCCGCTTCCACTCCGAGGACTACATTGACTTCCTG
CAGAGAGTCAGCCCCACCAATATGCAAGGCTTCACCAAGAGTCTTAATGCCTTCAACGTAGGCGATGACT
GCCCAGTGTTTCCCGGGCTCTTTGAGTTCTGCTCGCGTTACACAGGCGCATCTCTGCAAGGAGCAACCCA
GCTGAACAACAAGATCTGTGATATTGCCATTAACTGGGCTGGTGGTCTGCACCATGCCAAGAAGTTTGAG
GCCTCTGGCTTCTGCTATGTCAACGACATTGTGATTGGCATCCTGGAGCTGCTCAAGTACCACCCTCGGG
TGCTCTACATTGACATTGACATCCACCATGGTGACGGGGTTCAAGAAGCTTTCTACCTCACTGACCGGGT
CATGACGGTGTCCTTCCACAAATACGGAAATTACTTCTTCCCTGGCACAGGTGACATGTATGAAGTCGGG
GCAGAGAGTGGCCGCTACTACTGTCTGAACGTGCCCCTGCGGGATGGCATTGATGACCAGAGTTACAAGC
ACCTTTTCCAGCCGGTTATCAACCAGGTAGTGGACTTCTACCAACCCACGTGCATTGTGCTCCAGTGTGG
AGCTGACTCTCTGGGCTGTGATCGATTGGGCTGCTTTAACCTCAGCATCCGAGGGCATGGGGAATGCGTT
GAATATGTCAAGAGCTTCAATATCCCTCTACTCGTGCTGGGTGGTGGTGGTTATACTGTCCGAAATGTTG
CCCGCTGCTGGACATATGAGACATCGCTGCTGGTAGAAGAGGCCATTAGTGAGGAGCTTCCCTATAGTGA
ATACTTCGAGTACTTTGCCCCAGACTTCACACTTCATCCAGATGTCAGCACCCGCATCGAGAATCAGAAC
TCACGCCAGTATCTGGACCAGATCCGCCAGACAATCTTTGAAAACCTGAAGATGCTGAACCATGCACCTA
GTGTCCAGATTCATGACGTGCCTGCAGACCTCCTGACCTATGACAGGACTGATGAGGCTGATGCAGAGGA
GAGGGGTCCTGAGGAGAACTATAGCAGGCCAGAGGCACCCAATGAGTTCTATGATGGAGACCATGACAAT
GACAAGGAAAGCGATGTGGAGATT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC200605 protein sequence
Red=Cloning site Green=Tags(s)

MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFL
QRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFE
ASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVG
AESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECV
EYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQN
SRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_003883
ORF Size 1284 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003883.2, NP_003874.2
RefSeq Size 1965 bp
RefSeq ORF 1287 bp
Locus ID 8841
UniProt ID O15379
Cytogenetics 5q31.3
Domains Hist_deacetyl
Protein Families Druggable Genome, Transcription Factors
MW 48.8 kDa
Summary Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_003883" in other vectors (6)
SKU Description Size Price
RC200605L1 Lenti ORF clone of Human histone deacetylase 3 (HDAC3), Myc-DDK-tagged 10 ug
$757.00
RC200605L2 Lenti ORF clone of Human histone deacetylase 3 (HDAC3), mGFP tagged 10 ug
$757.00
RC200605L3 Lenti ORF clone of Human histone deacetylase 3 (HDAC3), Myc-DDK-tagged 10 ug
$757.00
RC200605L4 Lenti ORF clone of Human histone deacetylase 3 (HDAC3), mGFP tagged 10 ug
$757.00
RG200605 HDAC3 (tGFP-tagged) - Human histone deacetylase 3 (HDAC3) 10 ug
$489.00 $657.00
SC112704 HDAC3 (untagged)-Human histone deacetylase 3 (HDAC3) 10 ug
$457.00

Plasmid Map for RC200605

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC200605
Circular map for RC200605

file-alt Citations

A Low Protein Diet during Gestation and Lactation Increases Hepatic Lipid Accumulation through Autophagy and Histone Deacetylase
Wang, Xu, Hernández-Saavedra et al
Am. J. Physiol. Endocrinol. Metab. (2020)
Cited by 4
AI Summary: In this study, the OriGene HDAC3 plasmid (pcmv-HDAC3) was used to investigate the role of HDAC3 in regulating hepatic lipid accumulation and autophagy in HepG2 cells in response to a low protein diet.
Snippet: HDAC3, HepG2 cells were cultured as described above and transfected with either the control 212 plasmid (Vector) or LC3-containing GFP (LC3) or HDAC3 plasmid (pcmv-HDAC3, HDAC3, 213 OriGene). The empty plpcx-GFP vector was used as a transfection control;- HDAC3, HepG2 cells were cultured as described above and transfected with either the control 212 plasmid (Vector) or LC3-containing GFP (LC3) or HDAC3 plasmid (pcmv-HDAC3, HDAC3, 213 OriGene). …
Acetylation is essential for nuclear heme oxygenase-1-enhanced tumor growth and invasiveness
Hsu, Chiang, Li et al
Oncogene (2017) 36 (49), 6805-6814 DOI: 10.1038/onc.2017.294
Cited by 38
AI Summary: In this study, OriGene products including the Myc-DDK-tagged HO-1 expression plasmid (RC210307) and HO-1-specific antibody (TA500429) were used to overexpress and detect HO-1 protein, respectively, enabling the investigation of HO-1 acetylation and its role in cancer cell growth and invasiveness.
Hepcidin is regulated by promoter-associated histone acetylation and HDAC3
Pasricha, Lim, Duarte et al
Nat Commun (2017) 8 (1), 403 DOI: 10.1038/s41467-017-00500-z
AI Summary: OriGene products pCMV6 entry vector containing HDAC3 (RC200605) and empty vector control (PS100001) were used to transfect Huh7 cells, enabling the study of HDAC3's role in regulating hepcidin expression via epigenetic mechanisms.
Snippet: Huh7 cells at 70–80% confluency were transfected in antibiotic-free media with pCMV6 entry vector containing either HDAC3 (DDK tagged, Origene, RC200605) or no gene (empty vector control, Origene, PS100001) using Lipofectamine LTX Plus (Thermo fisher Scientific)
FigureFigureFigure
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products