OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAB6A (NM_002869) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC200432
RAB6A (Myc-DDK-tagged)-Human RAB6A, member RAS oncogene family (RAB6A), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA322943 Anti-RAB6A Rabbit Polyclonal Antibody
100 ul
$305.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "RAB6A or NM_002869"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RAB6A
Synonyms RAB6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200432 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCACGGGCGGAGACTTCGGGAATCCGCTGAGGAAATTCAAGCTGGTGTTCCTGGGGGAGCAAAGCG
TTGGAAAGACATCTTTGATCACCAGATTCATGTATGACAGTTTTGACAACACCTATCAGGCAACAATTGG
CATTGACTTTTTATCAAAAACTATGTACTTGGAGGATCGAACAATCAGGCTTCAGCTGTGGGATACTGCG
GGTCAGGAACGTTTCCGTAGCCTCATTCCCAGTTACATCCGTGATTCTGCTGCAGCTGTAGTAGTTTACG
ATATCACAAATGTTAACTCATTCCAGCAAACTACAAAGTGGATTGATGATGTCAGAACAGAAAGAGGAAG
TGATGTTATCATCATGCTAGTAGGAAATAAAACAGATCTTGCTGACAAGAGGCAAGTGTCAATTGAGGAG
GGAGAGAGGAAAGCCAAAGAGCTGAATGTTATGTTTATTGAAACTAGTGCAAAAGCTGGATACAATGTAA
AGCAGCTCTTTCGACGTGTAGCAGCAGCTTTGCCGGGAATGGAAAGCACACAGGACAGAAGCAGAGAAGA
TATGATTGACATAAAACTGGAAAAGCCTCAGGAGCAACCAGTCAGTGAAGGAGGCTGTTCCTGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC200432 protein sequence
Red=Cloning site Green=Tags(s)

MSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTA
GQERFRSLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEE
GERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSEGGCSC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_002869
ORF Size 624 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002869.5
RefSeq Size 3419 bp
RefSeq ORF 627 bp
Locus ID 5870
UniProt ID P20340, A0A024R5H8
Cytogenetics 11q13.4
Domains RAB, RAN, ras, RAS, RHO
Protein Families Druggable Genome
MW 23.5 kDa
Summary This gene encodes a member of the RAB family, which belongs to the small GTPase superfamily. GTPases of the RAB family bind to various effectors to regulate the targeting and fusion of transport carriers to acceptor compartments. This protein is located at the Golgi apparatus, which regulates trafficking in both a retrograde (from early endosomes and Golgi to the endoplasmic reticulum) and an anterograde (from the Golgi to the plasma membrane) directions. Myosin II is an effector of this protein in these processes. This protein is also involved in assembly of human cytomegalovirus (HCMV) by interacting with the cellular protein Bicaudal D1, which interacts with the HCMV virion tegument protein, pp150. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. provided by RefSeq, Aug 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_002869" in other vectors (4)
SKU Description Size Price
RC200432L3 Lenti ORF clone of Human RAB6A, member RAS oncogene family (RAB6A), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC200432L4 Lenti ORF clone of Human RAB6A, member RAS oncogene family (RAB6A), transcript variant 1, mGFP tagged 10 ug
$600.00
RG200432 RAB6A (tGFP-tagged) - Human RAB6A, member RAS oncogene family (RAB6A), transcript variant 1 10 ug
$489.00 $500.00
SC321570 RAB6A (untagged)-Human RAB6A, member RAS oncogene family (RAB6A), transcript variant 1 10 ug
$300.00

Plasmid Map for RC200432

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC200432
Circular map for RC200432

file-alt Citations

Autoantibody against the Rab6A/Rab6B in primary autoimmune cerebellar ataxia associated with Sjogren's syndrome: A case report
Guo, Ren, Fan et al
J Neuroimmunol (2021) 359, 577667 DOI: 10.1016/j.jneuroim.2021.577667
Cited by 7
AI Summary: OriGene’s full-length human RAB6A and RAB6B cDNA expression plasmids (Cat. RC200432 and RC216303) were used to verify the interaction between patient autoantibodies and Rab6A/B proteins via recombinant cell-based assays in this study.
Snippet: For cell-based assay (CBA), cells were seeded on sterile cover glasses 24 h before transfection. The full-length human RAB6A and RAB6B cDNA expression plasmid pCMV6 was purchased from Origene (Cat. RC200432 and Cat. RC216303, Origene, USA)
Loss of C9ORF72 impairs autophagy and synergizes with polyQ Ataxin-2 to induce motor neuron dysfunction and cell death
Sellier, Campanari, Julie Corbier et al
EMBO J. (2016)
Cited by 414
AI Summary: OriGene contributed to this study by providing PCMV6 plasmids containing C-terminally Flag-tagged human cDNAs for SQSTM1 (P62), OPTN, SMCR8, WDR41, ULK1, NAP1, SINTBAD, TANK, and RAB GTPases, which were used to investigate the molecular mechanisms underlying autophagy regulation in ALS-FTD.
Snippet: PCMV6 containing C-terminally Flag-tagged human cDNAs of SQSTM1 (P62), OPTN, SMCR8, WDR41, ULK1, NAP1, SINTBAD, TANK, and RAB GTPases were purchased from OriGene
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products