OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BUB3 (NM_004725) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC200376
BUB3 (Myc-DDK-tagged)-Human budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA350151 Rabbit Polyclonal Anti-BUB3 Antibody
100 ul
$205.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "BUB3 or NM_004725"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BUB3
Synonyms BUB3L; hBUB3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200376 representing NM_004725
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCGGTTCTAACGAGTTCAAGCTGAACCAGCCACCCGAGGATGGCATCTCCTCCGTGAAGTTCAGCC
CCAACACCTCCCAGTTCCTGCTTGTCTCCTCCTGGGACACGTCCGTGCGTCTCTACGATGTGCCGGCCAA
CTCCATGCGGCTCAAGTACCAGCACACCGGCGCCGTCCTGGACTGCGCCTTCTACGATCCAACGCATGCC
TGGAGTGGAGGACTAGATCATCAATTGAAAATGCATGATTTGAACACTGATCAAGAAAATCTTGTTGGGA
CCCATGATGCCCCTATCAGATGTGTTGAATACTGTCCAGAAGTGAATGTGATGGTCACTGGAAGTTGGGA
TCAGACAGTTAAACTGTGGGATCCCAGAACTCCTTGTAATGCTGGGACCTTCTCTCAGCCTGAAAAGGTA
TATACCCTCTCAGTGTCTGGAGACCGGCTGATTGTGGGAACAGCAGGCCGCAGAGTGTTGGTGTGGGACT
TACGGAACATGGGTTACGTGCAGCAGCGCAGGGAGTCCAGCCTGAAATACCAGACTCGCTGCATACGAGC
GTTTCCAAACAAGCAGGGTTATGTATTAAGCTCTATTGAAGGCCGAGTGGCAGTTGAGTATTTGGACCCA
AGCCCTGAGGTACAGAAGAAGAAGTATGCCTTCAAATGTCACAGACTAAAAGAAAATAATATTGAGCAGA
TTTACCCAGTCAATGCCATTTCTTTTCACAATATCCACAATACATTTGCCACAGGTGGTTCTGATGGCTT
TGTAAATATTTGGGATCCATTTAACAAAAAGCGACTGTGCCAATTCCATCGGTACCCCACGAGCATCGCA
TCACTTGCCTTCAGTAATGATGGGACTACGCTTGCAATAGCGTCATCATATATGTATGAAATGGATGACA
CAGAACATCCTGAAGATGGTATCTTCATTCGCCAAGTGACAGATGCAGAAACAAAACCCAAGTCACCATG
TACT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC200376 representing NM_004725
Red=Cloning site Green=Tags(s)

MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDPTHA
WSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWDPRTPCNAGTFSQPEKV
YTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCIRAFPNKQGYVLSSIEGRVAVEYLDP
SPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIA
SLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSPCT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_004725
ORF Size 984 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004725.4
RefSeq Size 2659 bp
RefSeq ORF 987 bp
Locus ID 9184
UniProt ID O43684
Cytogenetics 10q26.13
Domains WD40
Protein Families Druggable Genome
Protein Pathways Cell cycle
MW 37 kDa
Summary This gene encodes a protein involved in spindle checkpoint function. The encoded protein contains four WD repeat domains and has sequence similarity with the yeast BUB3 protein. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_004725" in other vectors (4)
SKU Description Size Price
RC200376L3 Lenti-ORF clone of BUB3 (Myc-DDK-tagged)-Human budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 1 10 ug
$600.00
RC200376L4 Lenti-ORF clone of BUB3 (mGFP-tagged)-Human budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 1 10 ug
$600.00
RG200376 BUB3 (tGFP-tagged) - Human budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 1 10 ug
$489.00 $500.00
SC319420 BUB3 (untagged)-Human budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 1 10 ug
$300.00

Plasmid Map for RC200376

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC200376
Circular map for RC200376

file-alt Citations

The RepID-CRL4 ubiquitin ligase complex regulates metaphase to anaphase transition via BUB3 degradation
Jang, Nathans, Fu et al
Nat Commun (2020) 11 (1), 24 DOI: 10.1038/s41467-019-13808-9
Cited by 42
AI Summary: OriGene products, including FLAG-tagged expression plasmids for CUL4A (RC214798), CUL4B (RC206935), DDB1 (RC208372), BUB3 (RC200376), RBBP7 (RC231256), and a human siRNA oligo Duplex for DDB1 (SR301160), were used for gene expression and knockdown experiments to investigate the roles of these proteins in regulating the metaphase to anaphase transition.
Snippet: … Human FLAG-tagged expression plasmids for CUL4A (RC214798), CUL4B (RC206935), DDB1 (RC208372), BUB3 (RC200376), and RBBP7 (RC231256) were purchased from ORIGENE. The human siRNA oligo Duplex for DDB1 was purchased from ORIGENE (SR301160). All SMARTpool ON-TARGETplus siRNA was purchased from Dharmacon: CUL4A (L-012610), CUL4B (L-017965), PML (L-006547), CDT2 (L-020543), SKP2 (L-003324), VprBP (L-062261), RBBP4 (L-012137), RBBP7 (L-011375), and negative control siRNA (D-001810). …
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products