OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TRAF4 (NM_004295) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC200345
TRAF4 (Myc-DDK-tagged)-Human TNF receptor-associated factor 4 (TRAF4)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA364567 TRAF4 rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "TRAF4 or NM_004295"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TRAF4
Synonyms CART1; MLN62; RNF83
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200345 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTGGCTTCGACTACAAGTTCCTGGAGAAGCCCAAGCGACGGCTGCTGTGCCCACTGTGCGGGAAGC
CCATGCGCGAGCCTGTGCAGGTTTCCACCTGCGGCCACCGTTTCTGCGATACCTGCCTGCAGGAGTTCCT
CAGTGAAGGAGTCTTCAAGTGCCCTGAGGACCAGCTTCCTCTGGACTATGCCAAGATCTACCCAGACCCG
GAGCTGGAAGTACAAGTATTGGGCCTGCCTATCCGCTGCATCCACAGTGAGGAGGGCTGCCGCTGGAGTG
GGCCACTACGTCATCTACAGGGCCACCTGAATACCTGCAGCTTCAATGTCATTCCCTGCCCTAATCGCTG
CCCCATGAAGCTGAGCCGCCGTGATCTACCTGCACACTTGCAGCATGACTGCCCCAAGCGGCGCCTCAAG
TGCGAGTTTTGTGGCTGTGACTTCAGTGGGGAGGCCTATGAGAGCCATGAGGGTATGTGCCCCCAGGAGA
GTGTCTACTGTGAGAATAAGTGTGGTGCCCGCATGATGCGGCGGCTGCTGGCCCAGCATGCCACCTCTGA
GTGCCCCAAGCGCACTCAGCCCTGCACCTACTGCACTAAGGAGTTCGTCTTTGACACCATCCAGAGCCAC
CAGTACCAGTGCCCAAGGCTGCCTGTTGCCTGCCCCAACCAATGTGGTGTGGGCACTGTGGCTCGGGAGG
ACCTGCCAGGCCATCTGAAGGACAGCTGTAACACCGCCCTGGTGCTCTGCCCATTCAAAGACTCCGGCTG
CAAGCACAGGTGCCCTAAGCTGGCAATGGCACGGCATGTGGAGGAGAGTGTGAAGCCACATCTGGCCATG
ATGTGTGCCCTGGTGAGCCGGCAACGGCAGGAGCTGCAGGAGCTTCGGCGAGAGCTGGAGGAGCTATCAG
TGGGCAGTGATGGCGTGCTCATCTGGAAGATTGGCAGCTATGGACGGCGGCTACAGGAGGCCAAGGCCAA
GCCCAACCTTGAGTGCTTCAGCCCAGCCTTCTACACACATAAGTATGGTTACAAGCTGCAGGTGTCTGCA
TTCCTCAATGGCAATGGCAGTGGTGAGGGCACACACCTCTCACTGTACATTCGTGTGCTGCCTGGTGCCT
TTGACAATCTCCTTGAGTGGCCCTTTGCCCGCCGTGTCACCTTCTCCCTGCTGGATCAGAGCGACCCTGG
GCTGGCTAAACCACAGCACGTCACTGAGACCTTCCACCCCGACCCAAACTGGAAGAATTTCCAGAAGCCA
GGCACGTGGCGGGGCTCCCTGGATGAGAGTTCTCTGGGCTTTGGTTATCCCAAGTTCATCTCCCACCAGG
ACATTCGAAAGCGAAACTATGTGCGGGATGATGCAGTCTTCATCCGTGCTGCTGTTGAACTGCCCCGGAA
GATCCTCAGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC200345 protein sequence
Red=Cloning site Green=Tags(s)

MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDP
ELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLK
CEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSH
QYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAM
MCALVSRQRQELQELRRELEELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSA
FLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP
GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKILS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_004295
ORF Size 1410 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004295.4
RefSeq Size 2902 bp
RefSeq ORF 1413 bp
Locus ID 9618
UniProt ID Q9BUZ4, A0A024QZ59
Cytogenetics 17q11.2
Domains MATH, RING, zf-TRAF
Protein Families Druggable Genome
Protein Pathways Pathways in cancer, Small cell lung cancer
MW 53.5 kDa
Summary This gene encodes a member of the TNF receptor associated factor (TRAF) family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. The encoded protein has been shown to interact with neurotrophin receptor, p75 (NTR/NTSR1), and negatively regulate NTR induced cell death and NF-kappa B activation. This protein has been found to bind to p47phox, a cytosolic regulatory factor included in a multi-protein complex known as NAD(P)H oxidase. This protein thus, is thought to be involved in the oxidative activation of MAPK8/JNK. Alternatively spliced transcript variants have been observed but the full-length nature of only one has been determined. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_004295" in other vectors (7)
SKU Description Size Price
RC200345L1 Lenti ORF clone of Human TNF receptor-associated factor 4 (TRAF4), Myc-DDK-tagged 10 ug
$757.00
RC200345L2 Lenti ORF clone of Human TNF receptor-associated factor 4 (TRAF4), mGFP tagged 10 ug
$757.00
RC200345L3 Lenti ORF clone of Human TNF receptor-associated factor 4 (TRAF4), Myc-DDK-tagged 10 ug
$757.00
RC200345L4 Lenti ORF clone of Human TNF receptor-associated factor 4 (TRAF4), mGFP tagged 10 ug
$757.00
RG200345 TRAF4 (tGFP-tagged) - Human TNF receptor-associated factor 4 (TRAF4) 10 ug
$489.00 $657.00
SC117456 TRAF4 (untagged)-Human TNF receptor-associated factor 4 (TRAF4) 10 ug
$457.00
SC320675 TRAF4 (untagged)-Human TNF receptor-associated factor 4 (TRAF4) 10 ug
$457.00

Plasmid Map for RC200345

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC200345
Circular map for RC200345

file-alt Citations

Stabilization of MCL-1 by E3 ligase TRAF4 confers radioresistance
Li, Gao, Li et al
Cell Death Dis (2022) 13 (12), 1053 DOI: 10.1038/s41419-022-05500-6
Cited by 26
AI Summary: OriGene products Flag-TRAF4 (Cat# RC200345) and Flag-MCL1 (Cat# RC200521) were used in this study to investigate the roles of TRAF4 and MCL-1 in mediating radioresistance in oral squamous cell carcinoma.
Snippet: : 1:200), HA tag (#ab18181, 1:5000) and His tag (#ab18184, 1:5000) were purchased from Abcam (Cambridge, UK). Plasmid construction Flag-TRAF4 (#RC200345) and Flag-MCL1 (#RC200521) were obtained from OriGene Technologies, Inc. His-Ub (#31815), HA-Akt (#73408), HA-Ub-K48 (#17605), and Flag-JOSD1 (#22547) were obtained from Addgene (Watertown, MA, USA). Flag-TRAF4 (C18A), HA-Ub-K48R, His-Ub (K6, K11
FigureFigureFigure
Ubiquitination of the DNA-damage checkpoint kinase CHK1 by TRAF4 is required for CHK1 activation
Yu, Li, Liu et al
J Hematol Oncol (2020) 13 (1), 40 DOI: 10.1186/s13045-020-00869-3
Cited by 30
AI Summary: OriGene products—including GFP-tag antibody (cat. #TA150032), rabbit anti-TRAF4 (cat. #RC200345L4), Flag-Chk1 (cat. #RC205094), and GFP-Chk1 (cat. #RC225807L4)—were used for immunoblotting, immunoprecipitation, and protein expression to investigate the roles of TRAF4 and CHK1 in colorectal cancer chemoresistance.
Snippet: GFP-tag (cat. #TA150032;IB, 1:4000;IP, 1: 400) antibody was obtained from OriGene (Rockville, MD, USA). Rabbit anti-TRAF4 (cat RC200345L4), Flag-Chk1 (cat. #RC205094), and GFP- Chk1 (cat. #RC225807L4) were obtained from OriGene. pCDNA3-HA
FigureFigureFigure
WB IP IHC IF
Exosomes mediate the cell-to-cell transmission of IFN-α-induced antiviral activity
Li, Liu, Liu et al
Nat. Immunol. (2013) 14 (8), 793-803 DOI: 10.1038/ni.2647
Cited by 513
AI Summary: OriGene products, specifically the IFNA1 cDNA clone (Cat# SC117416) and GAPDH antibody (Cat# TA802519), were used in this study to investigate the expression and detection of interferon-α and control proteins, thereby supporting the analysis of exosome-mediated antiviral activity.
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products