OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DUSP26 (NM_024025) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC200202
DUSP26 (Myc-DDK-tagged)-Human dual specificity phosphatase 26 (putative) (DUSP26)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA349909 Rabbit Polyclonal Anti-DUSP26 Antibody
100 ul
$205.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "DUSP26 or NM_024025"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DUSP26
Synonyms DSP-4; DUSP24; LDP-4; LDP4; MKP-8; MKP8; NATA1; NEAP; SKRP3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200202 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGCCCTGGTAACTGGCTTTGGGCTTCTATGACTTTTATGGCCCGCTTCTCCCGGAGTAGCTCAAGGT
CTCCTGTTCGAACTCGAGGGACCCTGGAGGAGATGCCAACCGTTCAACATCCTTTCCTCAATGTCTTCGA
GTTGGAGCGGCTCCTCTACACAGGCAAGACAGCCTGTAACCATGCCGACGAGGTCTGGCCAGGCCTCTAT
CTCGGAGACCAGGACATGGCTAACAACCGCCGGGAGCTTCGCCGCCTGGGCATCACGCACGTCCTCAATG
CCTCACACAGCCGGTGGCGAGGCACGCCCGAGGCCTATGAGGGGCTGGGCATCCGCTACCTGGGTGTTGA
GGCCCACGACTCGCCAGCCTTTGACATGAGCATCCACTTCCAGACGGCTGCCGACTTCATCCACCGGGCG
CTGAGCCAGCCAGGAGGGAAGATCCTGGTGCATTGTGCTGTGGGCGTGAGCCGATCCGCCACCCTGGTAC
TGGCCTACCTCATGCTGTACCACCACCTTACCCTCGTGGAGGCCATCAAGAAAGTCAAAGACCACCGAGG
CATCATCCCCAACCGGGGCTTCCTGAGGCAGCTCCTGGCCCTGGACCGCAGGCTGCGGCAGGGTCTGGAA
GCA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC200202 protein sequence
Red=Cloning site Green=Tags(s)

MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLY
LGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRA
LSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLE
A

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_024025
ORF Size 633 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024025.3
RefSeq Size 1665 bp
RefSeq ORF 636 bp
Locus ID 78986
UniProt ID Q9BV47
Cytogenetics 8p12
Domains DSPc
Protein Families Druggable Genome, Phosphatase
MW 23.9 kDa
Summary This gene encodes a member of the tyrosine phosphatase family of proteins and exhibits dual specificity by dephosphorylating tyrosine as well as serine and threonine residues. This gene has been described as both a tumor suppressor and an oncogene depending on the cellular context. This protein may regulate neuronal proliferation and has been implicated in the progression of glioblastoma through its ability to dephosphorylate the p53 tumor suppressor. Alternative splicing results in multiple transcript variants. provided by RefSeq, Feb 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_024025" in other vectors (4)
SKU Description Size Price
RC200202L3 Lenti ORF clone of Human dual specificity phosphatase 26 (putative) (DUSP26), Myc-DDK-tagged 10 ug
$600.00
RC200202L4 Lenti ORF clone of Human dual specificity phosphatase 26 (putative) (DUSP26), mGFP tagged 10 ug
$600.00
RG200202 DUSP26 (tGFP-tagged) - Human dual specificity phosphatase 26 (putative) (DUSP26) 10 ug
$489.00 $500.00
SC112322 DUSP26 (untagged)-Human dual specificity phosphatase 26 (putative) (DUSP26) 10 ug
$300.00

Plasmid Map for RC200202

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC200202
Circular map for RC200202

file-alt Citations

Dusp26 phosphatase regulates mitochondrial respiration and oxidative stress and protects neuronal cell death
Eroglu, Jin, Deane et al
Cell Mol Life Sci (2022) 79 (4), 198 DOI: 10.1007/s00018-022-04162-z
Cited by 9
AI Summary: OriGene contributed to this study by providing the plasmid encoding human Dusp26 (C-terminal Myc-Flag-tagged; product code RC200202), which was used to investigate the role of Dusp26 in mitochondrial function and neuronal cell survival.
Snippet: The dual specificity protein phosphatases (Dusps) control dephosphorylation of mitogen-activated protein kinases (MAPKs) as well as other substrates. Here, we report Save;The plasmids encoding human Dusp26 (C-terminal Myc-Flag-tagged) was purchased from Origene (RC200202). T
Decreased DUSP26 Expression Promotes Malignant Behavior in Glioblastoma Cells via Deregulation of MAPK and Akt Signaling Pathway
Chen, Zeng, Wu et al
Front Oncol (2021) 11, 622826 DOI: 10.3389/fonc.2021.622826
Cited by 8
AI Summary: OriGene products, specifically the DUSP26 Human cDNA ORF Clone (Cat# RC200665) and DUSP26 shRNA (Cat# TL309829), were used to manipulate DUSP26 expression in glioblastoma cell lines, enabling the study of its effects on cell behavior and signaling pathways in this research.
FigureFigureFigure
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products