OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SCAND1 (NM_033630) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC200079
SCAND1 (Myc-DDK-tagged)-Human SCAN domain containing 1 (SCAND1), transcript variant 2
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA315460 Rabbit polyclonal anti-SCAND1 antibody
100 ul
$380.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "SCAND1 or NM_033630"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SCAND1
Synonyms RAZ1; SDP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200079 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCTACGGAGCCGATCTTGGCGGCCACTGGGAGTCCCGCGGCGGTGCCACCGGAGAAACTGGAAG
GAGCCGGTTCGAGCTCAGCCCCTGAGCGTAACTGTGTGGGCTCCTCGCTGCCAGAGGCCTCACCGCCTGC
CCCTGAGCCTTCCAGTCCCAACGCCGCGGTCCCTGAAGCCATCCCTACGCCCCGAGCTGCGGCCTCCGCG
GCCCTGGAGCTGCCTCTCGGGCCCGCACCCGTGAGCGTAGCGCCTCAGGCCGAAGCTGAAGCGCGCTCCA
CACCAGGCCCCGCCGGCTCTAGACTCGGTCCCGAGACGTTCCGCCAGCGTTTCCGGCAGTTCCGCTACCA
GGATGCGGCGGGTCCCCGGGAGGCTTTCCGGCAGCTGCGGGAGCTGTCCCGCCAGTGGCTGCGGCCTGAC
ATCCGCACCAAGGAGCAGATCGTGGAGATGCTGGTGCAAGAGCAGCTGCTCGCCATCCTGCCCGAGGCGG
CTCGGGCCCGGCGGATCCGCCGCCGCACGGATGTGCGCATCACTGGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC200079 protein sequence
Red=Cloning site Green=Tags(s)

MAATEPILAATGSPAAVPPEKLEGAGSSSAPERNCVGSSLPEASPPAPEPSSPNAAVPEAIPTPRAAASA
ALELPLGPAPVSVAPQAEAEARSTPGPAGSRLGPETFRQRFRQFRYQDAAGPREAFRQLRELSRQWLRPD
IRTKEQIVEMLVQEQLLAILPEAARARRIRRRTDVRITG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_033630
ORF Size 537 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_033630.1, NP_361012.1
RefSeq Size 919 bp
RefSeq ORF 540 bp
Locus ID 51282
UniProt ID P57086, H0UIA5, Q9NZG6
Cytogenetics 20q11.23
Domains LER
Protein Families Transcription Factors
MW 19.1 kDa
Summary This gene encodes a SCAN box domain-containing protein. The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. This gene belongs to a family of genes that encode an isolated SCAN domain, but no zinc finger motif. This protein binds to and may regulate the function of the transcription factor myeloid zinc finger 1B. Alternate splicing results in multiple transcript variants.provided by RefSeq, Jan 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_033630" in other vectors (6)
SKU Description Size Price
RC200079L1 Lenti ORF clone of Human SCAN domain containing 1 (SCAND1), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC200079L2 Lenti ORF clone of Human SCAN domain containing 1 (SCAND1), transcript variant 2, mGFP tagged 10 ug
$600.00
RC200079L3 Lenti ORF clone of Human SCAN domain containing 1 (SCAND1), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC200079L4 Lenti ORF clone of Human SCAN domain containing 1 (SCAND1), transcript variant 2, mGFP tagged 10 ug
$600.00
RG200079 SCAND1 (tGFP-tagged) - Human SCAN domain containing 1 (SCAND1), transcript variant 2 10 ug
$489.00 $500.00
SC120121 SCAND1 (untagged)-Human SCAN domain containing 1 (SCAND1), transcript variant 2 10 ug
$300.00

Plasmid Map for RC200079

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC200079
Circular map for RC200079

file-alt Citations

MZF1 and SCAND1 Reciprocally Regulate CDC37 Gene Expression in Prostate Cancer
Eguchi, Prince, Tran et al
Cancers (Basel) (2019) 11 (6) DOI: 10.3390/cancers11060792
AI Summary: OriGene’s Human SCAND1 (NM_033630) open reading frame clone with Myc-DDK C-terminal tag (catalog# RC200079) was used to overexpress SCAND1 and investigate its role in regulating CDC37 gene expression in prostate cancer cells.
Snippet: Human SCAND1 (NM_033630) open reading frame clone with Myc-DDK C-terminal tag (RC200079) was purchased (Origene, Rockville, MD, USA) and designated as pCMV6-ScanD1-myc-Flag. pCMV-EGFP (NEPA Gene) was used as an overexpression control Cached
SCAND1 suppresses CDC37 gene transcription by repressing MZF1
Eguchi, Prince, Tran et al
bioRxiv (2019)
Snippet: Human SCAND1 (NM_033630) ORF clone with Myc-DDK C-terminal tag (RC200079) was purchased (Origene, Rockville, MD) and designated pCMV6- ScanD1-myc-Flag MZF1-siRNA A, B, and C (SR305183, OriGene, Rockville, MD) or non-silencing siRNA View as HTML;Human SCAND1 (NM_033630) ORF clone with Myc-DDK C-terminal tag (RC200079) was purchased (Origene, Rockville, MD) and designated pCMV6-ScanD1-myc-Flag MZF1-siRNA A, B, and C (SR305183, OriGene, Rockville, MD) or non-silencing siRNA View as HTML
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products