OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ccl2 (NM_011333) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR226804
Ccl2 (Myc-DDK-tagged) - Mouse chemokine (C-C motif) ligand 2 (Ccl2)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $289.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Ccl2 or NM_011333"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ccl2
Synonyms AI323594; HC11; JE; MCA; MCAF; MCP; MCP-; MCP-1; MCP1; Scy; Scya2; Sig; Sigje; SMC-C; SMC-CF
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR226804 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGTCCCTGTCATGCTTCTGGGCCTGCTGTTCACAGTTGCCGGCTGGAGCATCCACGTGTTGGCTC
AGCCAGATGCAGTTAACGCCCCACTCACCTGCTGCTACTCATTCACCAGCAAGATGATCCCAATGAGTAG
GCTGGAGAGCTACAAGAGGATCACCAGCAGCAGGTGTCCCAAAGAAGCTGTAGTTTTTGTCACCAAGCTC
AAGAGAGAGGTCTGTGCTGACCCCAAGAAGGAATGGGTCCAGACATACATTAAAAACCTGGATCGGAACC
AAATGAGATCAGAACCTACAACTTTATTTAAAACTGCATCTGCCCTAAGGTCTTCAGCACCTTTGAATGT
GAAGTTGACCCGTAAATCTGAAGCTAATGCATCCACTACCTTTTCCACAACCACCTCAAGCACTTCTGTA
GGAGTGACCAGTGTGACAGTGAAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR226804 protein sequence
Red=Cloning site Green=Tags(s)

MQVPVMLLGLLFTVAGWSIHVLAQPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKL
KREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSV
GVTSVTVN

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_011333
ORF Size 444 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_011333.3, NP_035463.1
RefSeq Size 806 bp
RefSeq ORF 447 bp
Locus ID 20296
UniProt ID P10148
Cytogenetics 11 49.82 cM
MW 16.3 kDa
Summary This gene is one of several cytokine genes clustered on chromosome 11. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes and memory T cells but not for neutrophils. The human ortholog has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis, and atherosclerosis. provided by RefSeq, Sep 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_011333" in other vectors (4)
SKU Description Size Price
MC209362 Ccl2 (untagged) - Mouse chemokine (C-C motif) ligand 2 (Ccl2), (10ug) 10 ug
$240.00
MG226804 Ccl2 (tGFP-tagged) - Mouse chemokine (C-C motif) ligand 2 (Ccl2), (10ug) 10 ug
$489.00
MR226804L3 Lenti ORF clone of Ccl2 (Myc-DDK-tagged) - Mouse chemokine (C-C motif) ligand 2 (Ccl2) 10 ug
$450.00
MR226804L4 Lenti ORF clone of Ccl2 (mGFP-tagged) - Mouse chemokine (C-C motif) ligand 2 (Ccl2) 10 ug
$450.00

Plasmid Map for MR226804

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR226804
Circular map for MR226804

file-alt Citations

Overexpression of the monocyte chemokine CCL2 in dorsal root ganglion neurons causes a conditioning-like increase in neurite outgrowth and does so via a STAT3 dependent mechanism
Niemi, DeFrancesco-Lisowitz, Cregg et al
Exp. Neurol. (2016) 275 Pt 1, 25-37 DOI: 10.1016/j.expneurol.2015.09.018
AI Summary: OriGene’s mouse CCL2 cDNA was used to generate the CCL2 overexpression construct, enabling the study of CCL2’s role in macrophage accumulation and neurite outgrowth in dorsal root ganglion neurons.
Snippet: Mouse cDNA encoding the open reading frame of CCL2 (Origene;Rockville, MD) was cloned into a pAAV shuttle vector containing the AAV inverted terminal repeats with an expression cassette composed of the human elongation factor-1 alpha (EF1α) promoter, a multiple cloning site, the woodchuck hepatitis virus post-transcriptional regulatory element (WPRE), and a polyadenylation signal
FigureFigure
Characterization of the microseminoprotein, prostate-associated (Msmp) gene and its potential role in bone biology
Palenzuela
Thesis (2018)
Snippet: The CMV-driven plasmids encoding mCCL2, hCCL2, and mCCR2B tagged at their cterminus with Myc-Flag-epitopes were purchased from Origene (catalogue# MR226804, RC202180, and MR225805, respectively)
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products