Yod1 (NM_178691) Mouse Tagged ORF Clone

SKU
MR226493
Yod1 (Myc-DDK-tagged) - Mouse YOD1 OTU deubiquitinating enzyme 1 homologue (S. cerevisiae) (Yod1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Target Symbol Yod1
Synonyms 6330564D18Rik; 9930028C20Rik; Hshin7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR226493 representing NM_178691
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTGGAGGCGCCAAAGGCGGCCATTTTGGGGTCCCCCCCGCTGGTTACTCCGGCGCTGTCCCCCAGT
CTGAGGCTGGGACCAAGGCTGGCCCCGCAGGAGGCCGGCCGGCCGACACTATGTGGCGGGTCCGCTGCAA
GGCCAAGGGTGGCACCCACCTTTTGCAGGGTCTTTCCAGCCGGACCCGCTTACGGGAGCTGCAGGGCCAA
ATCGCCGCTATCACCGGCATCGCTCCCGGCAGTCAGCGAATCCTCGTTGGCTACCCGCCCGAGTGCCTGG
ATCTCAGCGACCGGGACATCACTCTTGGGGACCTGCCCATCCAGTCAGGTGACATGCTGATTGTTGAAGA
AGACCAAACCAGACCAAAAGCTTCACCTGCGTTTTCAAAATATGGTGCTCCTAGTTATGTCAGGGAAGCT
CTGCCTGTGCTTACCAGAACCGCAGTCCCAGCAGACAACTCTTGCCTCTTTACCAGTGTGTACTATGTCG
TGGAAGGAGGAGTCTTGAATCCAGCTTGTGCCCCTGAGATGAGACGCCTCATAGCACAAATTGTAGCAAG
TGATCCAGTCTTGTATAGTGAGGCGATACTGGGAAAGACAAACGAAGACTACTGTGATTGGATCAGAAGG
GATGATACGTGGGGGGGGGCAATCGAGATCTCAATCCTGTCTAAGTTTTACCAATGTGAAATATGTGTAG
TAGATACACAGACAGTCAGAATTGATCGTTTTGGGGAAGATGCAGGATATACCAAAAGAGTTCTGCTTAT
CTACGATGGCATTCACTACGATCCGCTTCAGCGTAACTTCCCTGATCCAGATACCCCTCCTCTGACCATT
TTCTCCTCAAATGATGATATTGTTCTTGTACAAGCACTGGAATTAGCTGATGAAGCTAGAAGAAAGAGAC
AGTTCACTGATGTAAACCGCTTCACCCTGAGATGCATGATCTGTCAGAAGGGCCTAACCGGACAAGCAGA
AGCAAGGGACCATGCCAGGGAGACAGGCCATACCAACTTTGGAGAGGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR226493 representing NM_178691
Red=Cloning site Green=Tags(s)

MFGGAKGGHFGVPPAGYSGAVPQSEAGTKAGPAGGRPADTMWRVRCKAKGGTHLLQGLSSRTRLRELQGQ
IAAITGIAPGSQRILVGYPPECLDLSDRDITLGDLPIQSGDMLIVEEDQTRPKASPAFSKYGAPSYVREA
LPVLTRTAVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPVLYSEAILGKTNEDYCDWIRR
DDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTI
FSSNDDIVLVQALELADEARRKRQFTDVNRFTLRCMICQKGLTGQAEARDHARETGHTNFGEV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_178691
ORF Size 1029 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_178691.4, NP_848806.2
RefSeq Size 3843 bp
RefSeq ORF 1032 bp
Locus ID 226418
UniProt ID Q8CB27
Cytogenetics 1 E4
MW 37.9 kDa
Summary Hydrolase that can remove conjugated ubiquitin from proteins and participates in endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins. May act by triming the ubiquitin chain on the associated substrate to facilitate their threading through the VCP/p97 pore. Ubiquitin moieties on substrates may present a steric impediment to the threading process when the substrate is transferred to the VCP pore and threaded through VCP's axial channel. Mediates deubiquitination of 'Lys-27'-, 'Lys-29'- and 'Lys-33'-linked polyubiquitin chains. Also able to hydrolyze 'Lys-11'-linked ubiquitin chains. Cleaves both polyubiquitin and di-ubiquitin. May play a role in macroautophagy, regulating for instance the clearance of damaged lysosomes. May recruit PLAA, UBXN6 and VCP to damaged lysosome membranes decorated with K48-linked ubiquitin chains and remove these chains allowing autophagosome formation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Yod1 (NM_178691) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC212783 Yod1 (untagged) - Mouse YOD1 OTU deubiquitinating enzyme 1 homologue (S. cerevisiae) (Yod1), (10ug) 10 ug
$732.00
MG226493 Yod1 (tGFP-tagged) - Mouse YOD1 OTU deubiquitinating enzyme 1 homologue (S. cerevisiae) (Yod1), (10ug) 10 ug
$886.00
MR226493L3 Lenti ORF clone of Yod1 (Myc-DDK-tagged) - Mouse YOD1 OTU deubiquitinating enzyme 1 homologue (S. cerevisiae) (Yod1) 10 ug
$986.00
MR226493L4 Lenti ORF clone of Yod1 (mGFP-tagged) - Mouse YOD1 OTU deubiquitinating enzyme 1 homologue (S. cerevisiae) (Yod1) 10 ug
$986.00
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.