OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ffar1 (NM_194057) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR222997
Ffar1 (Myc-DDK-tagged) - Mouse free fatty acid receptor 1 (Ffar1)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Ffar1 or NM_194057"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ffar1
Synonyms Gpr40
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR222997 representing NM_194057
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCTGCCCCCACAGCTCTCCTTCGCTCTCTATGTATCTGCCTTTGCGCTGGGCTTTCCATTGAACT
TGTTAGCCATCCGAGGCGCAGTGTCCCACGCTAAACTGCGACTCACTCCCAGCTTGGTCTACACTCTCCA
TCTGGGCTGCTCTGATCTCCTACTGGCCATCACTCTGCCCCTGAAGGCTGTGGAGGCCCTGGCTTCTGGA
GCCTGGCCCCTGCCGCTCCCCTTCTGCCCAGTCTTTGCCTTGGCCCACTTTGCTCCCCTCTACGCAGGCG
GAGGCTTCCTAGCTGCTCTCAGCGCTGGCCGCTACCTGGGGGCTGCCTTCCCCTTCGGGTACCAAGCCAT
CCGGAGGCCCCGCTATTCCTGGGGTGTGTGTGTGGCTATATGGGCCCTTGTCCTCTGCCACCTGGGGCTG
GCCCTTGGCTTGGAGACTTCCGGAAGCTGGCTGGACAACAGTACCAGTTCCCTGGGCATCAACATACCCG
TGAATGGCTCCCCGGTCTGCCTGGAAGCCTGGGATCCCGACTCTGCCCGCCCTGCCCGTCTCAGTTTCTC
CATTCTGCTCTTCTTTCTGCCCTTGGTCATCACTGCCTTCTGCTATGTGGGCTGCCTCCGGGCCCTGGTG
CGCTCAGGCCTGAGCCACAAACGGAAGCTCAGGGCAGCTTGGGTGGCCGGAGGCGCTCTCCTCACACTCC
TGCTCTGCCTGGGGCCCTATAATGCCTCCAATGTGGCTAGTTTCATAAACCCGGACCTAGGAGGCTCCTG
GAGGAAGTTGGGACTCATCACAGGGGCCTGGAGTGTGGTACTCAACCCACTGGTCACTGGCTACTTGGGA
ACAGGTCCTGGACGGGGAACAATATGTGTGACGAGGACTCAAAGAGGAACAATTCAGAAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR222997 representing NM_194057
Red=Cloning site Green=Tags(s)

MDLPPQLSFALYVSAFALGFPLNLLAIRGAVSHAKLRLTPSLVYTLHLGCSDLLLAITLPLKAVEALASG
AWPLPLPFCPVFALAHFAPLYAGGGFLAALSAGRYLGAAFPFGYQAIRRPRYSWGVCVAIWALVLCHLGL
ALGLETSGSWLDNSTSSLGINIPVNGSPVCLEAWDPDSARPARLSFSILLFFLPLVITAFCYVGCLRALV
RSGLSHKRKLRAAWVAGGALLTLLLCLGPYNASNVASFINPDLGGSWRKLGLITGAWSVVLNPLVTGYLG
TGPGRGTICVTRTQRGTIQK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_194057
ORF Size 900 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_194057.2, NP_918946.2
RefSeq Size 903 bp
RefSeq ORF 903 bp
Locus ID 233081
UniProt ID Q76JU9
Cytogenetics 7 B1
MW 32.3 kDa
Summary G-protein coupled receptor for medium and long chain saturated and unsaturated fatty acids that plays an important role in glucose homeostasis. Fatty acid binding increases glucose-stimulated insulin secretion, and may also enhance the secretion of glucagon-like peptide 1 (GLP-1). May also play a role in bone homeostasis; receptor signaling activates pathways that inhibit osteoclast differentiation (PubMed:23335512). Ligand binding leads to a conformation change that triggers signaling via G-proteins that activate phospholipase C, leading to an increase of the intracellular calcium concentration. Seems to act through a G(q) and G(i)-mediated pathway.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_194057" in other vectors (4)
SKU Description Size Price
MC212962 Ffar1 (untagged) - Mouse free fatty acid receptor 1 (Ffar1), (10ug) 10 ug
$300.00
MG222997 Ffar1 (tGFP-tagged) - Mouse free fatty acid receptor 1 (Ffar1), (10ug) 10 ug
$489.00 $500.00
MR222997L3 Lenti ORF clone of Ffar1 (Myc-DDK-tagged) - Mouse free fatty acid receptor 1 (Ffar1) 10 ug
$600.00
MR222997L4 Lenti ORF clone of Ffar1 (mGFP-tagged) - Mouse free fatty acid receptor 1 (Ffar1) 10 ug
$600.00

Plasmid Map for MR222997

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR222997
Circular map for MR222997

file-alt Citations

Discovery of Gut-Targeted GPR40 Agonist K-757 and GPR119 Agonist K-833, a Combination Treatment for Metabolic Disorders
Moyes, He, Mathieu et al
J Med Chem (2025)
Cited by 3
AI Summary: OriGene’s mGPR40-carrying plasmid (MR222997) was used to generate HEK293 cells stably expressing mouse GPR40, enabling the study of GPR40 agonist activity in this research.
Snippet: HEK293 cells stably expressing mouse GPR40 were generated by transfection of mGPR40-carrying plasmid (Origene, MR222997) into HEK293 cells and selection using
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products