OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Pdcd1lg2 (NM_021396) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR222499
Pdcd1lg2 (Myc-DDK-tagged) - Mouse programmed cell death 1 ligand 2 (Pdcd1lg2)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA386142 Recombinant Anti-PD-L2 (Clone TY25)
200 ug
$770.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Pdcd1lg2 or NM_021396"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Pdcd1lg2
Synonyms B7-DC; Btdc; F730015O22Rik; PD-L2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR222499 representing NM_021396
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCTCCTGCTGCCGATACTGAACCTGAGCTTACAACTTCATCCTGTAGCAGCTTTATTCACCGTGA
CAGCCCCTAAAGAAGTGTACACCGTAGACGTCGGCAGCAGTGTGAGCCTGGAGTGCGATTTTGACCGCAG
AGAATGCACTGAACTGGAAGGGATAAGAGCCAGTTTGCAGAAGGTAGAAAATGATACGTCTCTGCAAAGT
GAAAGAGCCACCCTGCTGGAGGAGCAGCTGCCCCTGGGAAAGGCTTTGTTCCACATCCCTAGTGTCCAAG
TGAGAGATTCCGGGCAGTACCGTTGCCTGGTCATCTGCGGGGCCGCCTGGGACTACAAGTACCTGACGGT
GAAAGTCAAAGCTTCTTACATGAGGATAGACACTAGGATCCTGGAGGTTCCAGGTACAGGGGAGGTGCAG
CTTACCTGCCAGGCTAGAGGTTATCCCCTAGCAGAAGTGTCCTGGCAAAATGTCAGTGTTCCTGCCAACA
CCAGCCACATCAGGACCCCCGAAGGCCTCTACCAGGTCACCAGTGTTCTGCGCCTCAAGCCTCAGCCTAG
CAGAAACTTCAGCTGCATGTTCTGGAATGCTCACATGAAGGAGCTGACTTCAGCCATCATTGACCCTCTG
AGTCGGATGGAACCCAAAGTCCCCAGAACGTGGCCACTTCATGTTTTCATCCCGGCCTGCACCATCGCTT
TGATCTTCCTGGCCATAGTGATAATCCAGAGAAAGAGGATC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR222499 representing NM_021396
Red=Cloning site Green=Tags(s)

MLLLLPILNLSLQLHPVAALFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQS
ERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQ
LTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPL
SRMEPKVPRTWPLHVFIPACTIALIFLAIVIIQRKRI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_021396
ORF Size 741 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021396.2, NP_067371.1
RefSeq Size 3415 bp
RefSeq ORF 744 bp
Locus ID 58205
UniProt ID Q9WUL5
Cytogenetics 19 C1
MW 28.3 kDa
Summary Involved in the costimulatory signal essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_021396" in other vectors (6)
SKU Description Size Price
MC210166 Pdcd1lg2 (untagged) - Mouse programmed cell death 1 ligand 2 (Pdcd1lg2), (10ug) 10 ug
$450.00
MG222499 Pdcd1lg2 (tGFP-tagged) - Mouse programmed cell death 1 ligand 2 (Pdcd1lg2), (10ug) 10 ug
$489.00 $500.00
MR222499L1 Lenti ORF clone of Pdcd1lg2 (Myc-DDK-tagged) - Mouse programmed cell death 1 ligand 2 (Pdcd1lg2) 10 ug
$600.00
MR222499L2 Lenti ORF clone of Pdcd1lg2 (mGFP-tagged) - Mouse programmed cell death 1 ligand 2 (Pdcd1lg2) 10 ug
$600.00
MR222499L3 Lenti ORF clone of Pdcd1lg2 (Myc-DDK-tagged) - Mouse programmed cell death 1 ligand 2 (Pdcd1lg2) 10 ug
$600.00
MR222499L4 Lenti ORF clone of Pdcd1lg2 (mGFP-tagged) - Mouse programmed cell death 1 ligand 2 (Pdcd1lg2) 10 ug
$600.00

Plasmid Map for MR222499

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR222499
Circular map for MR222499

file-alt Citations

Abstract B136: Development of PD-L1/L2 over-expressing mouse liver cancer models to test the efficacy of anti-PD1 therapy for hepatocellular carcinoma
Ou, Chen, Su et al
Cancer Immunology Research (2016)
AI Summary: OriGene products PD-L1 (MR203953) and PD-L2 (MR222499) expression plasmids were used to transfect murine liver cancer cell lines, enabling the development of over-expressing models to study anti-PD1 therapy efficacy in hepatocellular carcinoma.
Snippet: therapy for HCC. PD-L1 (MR203953;Origene Technologies, Rockville, MD) or PD-L2 (MR222499;Origene Technologies) was transfected into the BNL-MEA murine liver cancer cell lines and stable clones were selected. Effects of ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products