OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Nanos2 (NM_194064) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR222297
Nanos2 (Myc-DDK-tagged) - Mouse nanos homolog 2 (Drosophila) (Nanos2)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $289.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Nanos2 or NM_194064"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Nanos2
Synonyms nos2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR222297 representing NM_194064
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCTACCGCCCTTTGACATGTGGAGAGACTACTTTAACCTGAGCCAGGTGGTGATGGATATAATTC
AGAGCCGGAAGCAAAGACAGGAGGGTGAGGTAGCTGAGGAGCCCAACTCCAGGCCCCAGGAGAAGAGTGA
GCAGGACCTGGAGGGCTACCCTGGATGTCTGCCTACCATATGCAACTTCTGCAAGCACAATGGGGAGTCT
CGTCACGTCTACACCTCACACCAGCTGAAGACGCCTGAAGGGGTGGTTGTGTGTCCCATCCTGAGGCACT
ATGTGTGTCCTCTATGTGGAGCCACCGGCGACCAGGCTCATACACTCAAGTATTGTCCACTCAACAGCAG
TCAGCAGTCTCTCTACCGACGCAGTGGGCGAAACTCAGCTGGTCGCAGAGTCAAGCGA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR222297 representing NM_194064
Red=Cloning site Green=Tags(s)

MDLPPFDMWRDYFNLSQVVMDIIQSRKQRQEGEVAEEPNSRPQEKSEQDLEGYPGCLPTICNFCKHNGES
RHVYTSHQLKTPEGVVVCPILRHYVCPLCGATGDQAHTLKYCPLNSSQQSLYRRSGRNSAGRRVKR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_194064
ORF Size 408 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_194064.2, NP_918953.2
RefSeq Size 1439 bp
RefSeq ORF 411 bp
Locus ID 378430
UniProt ID P60322
Cytogenetics 7 A3
MW 16 kDa
Summary Plays a key role in the sexual differentiation of germ cells by promoting the male fate but suppressing the female fate. Represses the female fate pathways by suppressing meiosis, which in turn results in the promotion of the male fate. Maintains the suppression of meiosis by preventing STRA8 expression, which is required for premeiotic DNA replication, after CYP26B1 is decreased. Regulates the localization of the CCR4-NOT deadenylation complex to P-bodies and plays a role in recruiting the complex to trigger the degradation of mRNAs involved in meiosis. Required for the maintenance of the spermatogonial stem cell population. Not essential for the assembly of P-bodies but is required for the maintenance of their normal state.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_194064" in other vectors (4)
SKU Description Size Price
MC214663 Nanos2 (untagged) - Mouse nanos homolog 2 (Drosophila) (Nanos2), (10ug) 10 ug
$150.00
MG222297 Nanos2 (tGFP-tagged) - Mouse nanos homolog 2 (Drosophila) (Nanos2), (10ug) 10 ug
$350.00
MR222297L3 Lenti ORF clone of Nanos2 (Myc-DDK-tagged) - Mouse nanos homolog 2 (Drosophila) (Nanos2) 10 ug
$450.00
MR222297L4 Lenti ORF clone of Nanos2 (mGFP-tagged) - Mouse nanos homolog 2 (Drosophila) (Nanos2) 10 ug
$450.00

Plasmid Map for MR222297

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR222297
Circular map for MR222297

file-alt Citations

A Smaug2-Based Translational Repression Complex Determines the Balance between Precursor Maintenance versus Differentiation during Mammalian Neurogenesis
Amadei, Zander, Yang et al
J. Neurosci. (2015) 35 (47), 15666-81 DOI: 10.1523/JNEUROSCI.2172-15.2015
AI Summary: OriGene products contributed to this study by providing Flag-tagged expression constructs for mouse and human Smaug2 and Smaug1, as well as mouse Nanos1, Nanos2, Nanos3, and human Nanos1, which were used to investigate the roles of these proteins in neurogenesis.
Snippet: different mother. Plasmids and shRNAs. The Flag-tagged expression constructs for mouse and human Smaug2 and Smaug1 and mouse Nanos1, Nanos 2, and Nanos3 and human Nanos1 were obtained from OriGene. shRNA ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products