OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Pm20d2 (NM_001034867) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR222068
Pm20d2 (Myc-DDK-tagged) - Mouse peptidase M20 domain containing 2 (Pm20d2)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Pm20d2 or NM_001034867"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Pm20d2
Synonyms Acy1l2; Gm424
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR222068 representing NM_001034867
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTCCGGTGGTGGAGCGGCCGGCCGAGCCCGGCACGAGCAGCGCCGCCGAGCTGGAGCTGCTGAAAC
GGCGAGCGGCCGAGCGCATCGACGAGGCGGCCGAGCGCCTGGGCGCGCTGAGCCGCGCCATCTGGAGCGC
GCCCGAGCTGGCCTACGAAGAGCACCGCGCGCACGGCGAGCTCACGCGCTTCTTCGAGTGCGAGCCGCCG
GCCGCCTCGTGGGCGGTGCAGCCGCACTTCGGGCTCCCCACCGCCTTCCGTGCCGAGTGGGCGCCGCCGG
AGTCCGCGGCGGGGCCCCGCGCGCTGCAGGTGGCCTTCCTGTGCGAGTACGACGCGCTGCCAGCCCTGGG
CCACGCCTGCGGCCACAACCTCATCGCCGAGGTCGGGGTGGCTGCGGCGCTCGGCCTGCGGGCTGCGCTG
GAGAGCATCGCTGCGCCGCCGCCGGTCAAGGTGATTGTCCTGGGAACCCCTGCAGAAGAAGATGGTGGTG
GCAAAATTGATCTAATTGAAGCAGGTGCCTTCGAAAACCTTGATGTTGTTTTTATGGCTCATCCCTCTCA
GGAGAACGCTGCCTATCTCCCGGATGTGGCCGAGCACGATGTGACTGTGAAGTACTACGGAAAAGCGTCT
CACGCTGCCGCTTACCCTTGGGAGGGTGTGAACGCCTTGGACGCTGCAGTTCTTGCCTATACCAACCTCT
CTGTGTTAAGACAGCAGATGAAACCAACCTGGAGAGTTCATGGTATAATAAAAAACGGTGGTGTGAAGCC
CAATATCATCCCCTCTTACTCTGAACTCGTCTATTACTTCCGTGCGCCCTCCATGAAGGAGCTTCAAGTT
CTGACCAAAAAGGCAGAAGATTGCTTCAGAGCTGCGGCTTTGGCTACGGGCTGCACAGTAGACATTGAAA
GTGAAGCACATGATTATTACAATGTCATTCCCAATAAGACCCTGTGCAGTGCGTATACGGAGAACGGGAA
GAAACTGGGAATGGAGTTCATTTCAGAAGATGCGGTACTGAATGGCCCTTCAGGCTCTACTGATTTTGGA
AATGTCAGTTTCGTGGTTCCTGGGATTCACCCGTATTTTTACATTGGGACTGATGCCTTGAATCACACGG
AGCAGTACACAGAAGCTGCAGGATCACAAGCGGCTCAGCTGTACACGCTGCGTACAGCCAAGGCTCTGGC
AATGACCGCACTGGACGTCATCTTTAAGCCTGCATTGCTCGAAGGAGTCAGGAAGGAGTTTAAATGTAAA
CTTCAAGAAGAGCAGCTTTTAAATACAGCAGCA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR222068 representing NM_001034867
Red=Cloning site Green=Tags(s)

MGPVVERPAEPGTSSAAELELLKRRAAERIDEAAERLGALSRAIWSAPELAYEEHRAHGELTRFFECEPP
AASWAVQPHFGLPTAFRAEWAPPESAAGPRALQVAFLCEYDALPALGHACGHNLIAEVGVAAALGLRAAL
ESIAAPPPVKVIVLGTPAEEDGGGKIDLIEAGAFENLDVVFMAHPSQENAAYLPDVAEHDVTVKYYGKAS
HAAAYPWEGVNALDAAVLAYTNLSVLRQQMKPTWRVHGIIKNGGVKPNIIPSYSELVYYFRAPSMKELQV
LTKKAEDCFRAAALATGCTVDIESEAHDYYNVIPNKTLCSAYTENGKKLGMEFISEDAVLNGPSGSTDFG
NVSFVVPGIHPYFYIGTDALNHTEQYTEAAGSQAAQLYTLRTAKALAMTALDVIFKPALLEGVRKEFKCK
LQEEQLLNTAA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001034867
ORF Size 1293 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001034867.2, NP_001030039.2
RefSeq Size 5578 bp
RefSeq ORF 1296 bp
Locus ID 242377
UniProt ID A3KG59
Cytogenetics 4 A5
MW 46.5 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001034867" in other vectors (4)
SKU Description Size Price
MC213143 Pm20d2 (untagged) - Mouse peptidase M20 domain containing 2 (Pm20d2), (10ug) 10 ug
$503.00
MG222068 Pm20d2 (tGFP-tagged) - Mouse peptidase M20 domain containing 2 (Pm20d2), (10ug) 10 ug
$657.00
MR222068L3 Lenti ORF clone of Pm20d2 (Myc-DDK-tagged) - Mouse peptidase M20 domain containing 2 (Pm20d2) 10 ug
$757.00
MR222068L4 Lenti ORF clone of Pm20d2 (mGFP-tagged) - Mouse peptidase M20 domain containing 2 (Pm20d2) 10 ug
$757.00

Plasmid Map for MR222068

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR222068
Circular map for MR222068

file-alt Citations

Cooperative enzymatic control of N-acyl amino acids by PM20D1 and FAAH
Kim, Terrell, Li et al
Elife (2020) 9 DOI: 10.7554/eLife.55211
AI Summary: OriGene products—specifically FAAH-flag (MR209084), ACY1-flag (MR206415), CNDP1-flag (MR219018), and CNDP2-flag (MR207616) transfected constructs—were used to express and study the roles of these enzymes in the cooperative enzymatic regulation of N-acyl amino acids in this research.
Snippet: Mouse line (M. musculus) C57BL/6J Jackson Labs 000664 Transfected construct (M. musculus) PM20D1-flag Addgene 84566 Transfected construct (M. musculus) FAAH-flag Origene MR209084 Transfected construct (M. musculus) ACY1-flag Origene MR206415 Transfected construct (M. musculus) CNDP1-flag Origene MR219018 Transfected construct (M. musculus) CNDP2-flag Origene MR207616
FigureFigureFigure
Family-wide Annotation of Enzymatic Pathways by Parallel In Vivo Metabolomics
Kim, Li, Terrell et al
Cell Chem Biol (2019) 26 (11), 1623-1629.e3 DOI: 10.1016/j.chembiol.2019.09.009
AI Summary: OriGene products, specifically the mACY1 cDNA (MR206415), mPM20D2 cDNA (MR222068), mCNDP2 cDNA (MR207616), and mCNDP1 cDNA constructs, were used as sources of full-length mouse genes for generating adeno-associated viruses to study enzymatic pathways in vivo.
Snippet: …Full-length mouse _Pm20d1_, _Pm20d2_, _Cndp1, Cndp2_, and _Acy1_ cDNA (Origene) with C-terminal 6xHIS and Flag tags were subcloned into pENN.AAV8.CB7.CI.WPRE.rBG (Penn Vector Core) using the PstI/HindIII sites to generate AAV8 plasmids. … mACY1 cDNA, C-term myc-DDK tagged, Origene, MR206415. mPM20D2 cDNA, C-term myc-DDK tagged, Origene, MR222068. mCNDP2 cDNA, C-term myc-DDK tagged, Origene, MR207616. …
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products