OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Raet1d (NM_020030) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR221464
Raet1d (Myc-DDK-tagged) - Mouse retinoic acid early transcript delta (Raet1d)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Raet1d or NM_020030"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Raet1d
Synonyms RAE-1delta
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR221464 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAAGGCAGCAGTGACCAAGCGCCATCATTTTATGATTCAGAAGCTGTTAATTCTACTGAGCTATG
GATACACCAACGGGCTAGATGATGCACACTCTCTTAGGTGCAACTTGACCATCAAGGCTCCTACCCCAGC
AGATGAAGTGAAGTGCTTCGTGGGTGAAATACTTATCCTCCATTTAAGTAACATAAACAAGACCATGACT
TCAGGTGACCCAGGGGAGACAGCAAATGCCACTGAAGTGGGGGAATGTTTAACACAACCTCTGAAAGATT
TGTGCCAGAAGTTGAGGGACAAGGTGTCTAACACCAAAGTGGACACTCACAAGACCAATGGTTACCCACA
TTTACAAGTCACCATGATTTATCCGCAAAGCCAGGGCCAAACTCCTAGTGCCACCTGGGAATTCAACATC
AGTGACAGTTACTTCTTCACCTTCTACACAGAGATTATGAGCTGGAGATCAGCTAATGATGAATCAGGGG
TTATCATGAATAAATGGAAAGATGATGGGGAATTTGTGAAACAATTGAAATTCTTGATACACGGATGCAG
TCAGAAAATGGATGAATTCTTAAAGCAGTCCAAGGAAAAGCCAAGATCAACCTCAAGGTCCCCCAGTATC
ACCCAGCTTACATCAACTTCCCCGCTTCCACCTACCAGCCACTCTACTTCTAAGAAAGGATTTATCTCTG
TGGGACTCATCTTCATATCTTTATTATTTGCATTTGCATTTGCAATG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR221464 protein sequence
Red=Cloning site Green=Tags(s)

MAKAAVTKRHHFMIQKLLILLSYGYTNGLDDAHSLRCNLTIKAPTPADEVKCFVGEILILHLSNINKTMT
SGDPGETANATEVGECLTQPLKDLCQKLRDKVSNTKVDTHKTNGYPHLQVTMIYPQSQGQTPSATWEFNI
SDSYFFTFYTEIMSWRSANDESGVIMNKWKDDGEFVKQLKFLIHGCSQKMDEFLKQSKEKPRSTSRSPSI
TQLTSTSPLPPTSHSTSKKGFISVGLIFISLLFAFAFAM

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_020030
ORF Size 747 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020030.2, NP_064414.1
RefSeq Size 1287 bp
RefSeq ORF 750 bp
Locus ID 56554
UniProt ID Q9JI58
Cytogenetics 10 A3
MW 27.9 kDa
Summary Acts as a ligand for KLRK1.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_020030" in other vectors (4)
SKU Description Size Price
MC210076 Raet1d (untagged) - Mouse retinoic acid early transcript delta (Raet1d), (10ug) 10 ug
$300.00
MG221464 Raet1d (tGFP-tagged) - Mouse retinoic acid early transcript delta (Raet1d), (10ug) 10 ug
$500.00
MR221464L3 Lenti ORF clone of Raet1d (Myc-DDK-tagged) - Mouse retinoic acid early transcript delta (Raet1d) 10 ug
$600.00
MR221464L4 Lenti ORF clone of Raet1d (mGFP-tagged) - Mouse retinoic acid early transcript delta (Raet1d) 10 ug
$600.00

Plasmid Map for MR221464

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR221464
Circular map for MR221464

file-alt Citations

Evasion of Innate Immunity Contributes to Small Cell Lung Cancer Progression and Metastasis
Zhu, Huang, Bender et al
Cancer Res (2021)
AI Summary: OriGene contributed to this study by providing the MICA (Cat# SC1200303) and Rae1 delta (Cat# MR221464) cDNA expression plasmids, which were used to generate stable cell lines for investigating the role of NK-activating ligands in small cell lung cancer progression.
Snippet: bovine serum (Gibco, Cat# 16000044). Stable expression cell lines MICA and Rae1 delta cDNA were purchased from Origene (MICA: Cat# SC1200303, Rae1 delta: Cat# MR221464). MICA and Rae1 delta fragments were cloned from plasmids by
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products