Nanos3 (NM_194059) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MR216314
Nanos3 (Myc-DDK-tagged) - Mouse nanos homolog 3 (Drosophila) (Nanos3)
$289.00 $300.00
In Stock*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Nanos3
Synonyms nos3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR216314 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGACTTTCAATCTTTGGACAGATTACCTAGGTCTGGCAAGACTGGTTGGGGCTCTGCATAAGGAAG
AGGAGCTTGATGTAAGGCTGGATCCCAAACCAGAGCCCAAGCCAAGTTCAGAAAGCCAGCAAGCCAGCAA
GGAATCCTCTGCAGCTCCTGAACGCTTATGTTCATTCTGCAAACACAATGGCGAGTCCCGTGCCATCTAT
CAGTCCCATGTCCTGAAGGATGAGGCAGGGCGGGTGCTGTGTCCCATTTTGCGGGATTATGTGTGTCCCC
AGTGTGGGGCCACTCAGGAGCACGCCCACACTCGACGCTTTTGCCCACTCACCAGCCAGGGCTACACTTC
TGTCTACTGCTACACCACCCGGAATTCTGCAGGCAAAAAGCTGACCCGGCCTGACAAGGCAAAGACACAG
GATGCTGGCCACCGCCTTGGAGGAGAAGCAGCAGCAGGTGTCTATGCAGGTTCCAAAAGTGGCAGGAAGC
CCCCTGGACCTTCACCCTCGGCCTGCTGTCCCTCCACTACGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR216314 protein sequence
Red=Cloning site Green=Tags(s)

MGTFNLWTDYLGLARLVGALHKEEELDVRLDPKPEPKPSSESQQASKESSAAPERLCSFCKHNGESRAIY
QSHVLKDEAGRVLCPILRDYVCPQCGATQEHAHTRRFCPLTSQGYTSVYCYTTRNSAGKKLTRPDKAKTQ
DAGHRLGGEAAAGVYAGSKSGRKPPGPSPSACCPSTTA

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_194059
ORF Size 534 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_194059.1, NM_194059.2, NP_918948.1
RefSeq Size 730 bp
RefSeq ORF 537 bp
Locus ID 244551
UniProt ID P60324
Cytogenetics 8 C2
MW 19.2 kDa
Summary Plays a role in the maintenance of the undifferentiated state of germ cells regulating the spermatogonia cell cycle and inducing a prolonged transit in G1 phase. Affects cell proliferation probably by repressing translation of specific mRNAs. Maintains the germ cell lineage by suppressing both Bax-dependent and -independent apoptotic pathways. Essential in the early stage embryo to protect the migrating primordial germ cells (PGCs) from apoptosis.UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_194059" in other vectors (4)
SKU Description Size Price
MC213198 Nanos3 (untagged) - Mouse nanos homolog 3 (Drosophila) (Nanos3), (10ug) 10 ug
$330.00
MG216314 Nanos3 (tGFP-tagged) - Mouse nanos homolog 3 (Drosophila) (Nanos3), (10ug) 10 ug
$500.00
MR216314L3 Lenti ORF clone of Nanos3 (Myc-DDK-tagged) - Mouse nanos homolog 3 (Drosophila) (Nanos3) 10 ug
$600.00
MR216314L4 Lenti ORF clone of Nanos3 (mGFP-tagged) - Mouse nanos homolog 3 (Drosophila) (Nanos3) 10 ug
$600.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products