OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Mecp2 (NM_010788) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR207745
Mecp2 (Myc-DDK-tagged) - Mouse methyl CpG binding protein 2 (Mecp2), transcript variant 2
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
2 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA389019 Anti-MeCP2 (Ser421) Antibody
100 ul
$610.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Mecp2 or NM_010788"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Mecp2
Synonyms 1500041B07Rik; D630021H01Rik; Mbd5; WBP10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR207745 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTAGCTGGGATGTTAGGGCTCAGGGAGGAAAAGTCAGAAGACCAGGATCTCCAGGGCCTCAGAGACA
AGCCACTGAAGTTTAAGAAGGCGAAGAAAGACAAGAAGGAGGACAAAGAAGGCAAGCATGAGCCACTACA
ACCTTCAGCCCACCATTCTGCAGAGCCAGCAGAGGCAGGCAAAGCAGAAACATCAGAAAGCTCAGGCTCT
GCCCCAGCAGTGCCAGAAGCCTCGGCTTCCCCCAAACAGCGGCGCTCCATTATCCGTGACCGGGGACCTA
TGTATGATGACCCCACCTTGCCTGAAGGTTGGACACGAAAGCTTAAACAAAGGAAGTCTGGCCGATCTGC
TGGAAAGTATGATGTATATTTGATCAATCCCCAGGGAAAAGCTTTTCGCTCTAAAGTAGAATTGATTGCA
TACTTTGAAAAGGTGGGAGACACCTCCTTGGACCCTAATGATTTTGACTTCACGGTAACTGGGAGAGGGA
GCCCCTCCAGGAGAGAGCAGAAACCACCTAAGAAGCCCAAATCTCCCAAAGCTCCAGGAACTGGCAGGGG
TCGGGGACGCCCCAAAGGGAGCGGCACTGGGAGACCAAAGGCAGCAGCATCAGAAGGTGTTCAGGTGAAA
AGGGTCCTGGAGAAGAGCCCTGGGAAACTTGTTGTCAAGATGCCTTTCCAAGCATCGCCTGGGGGTAAGG
GTGAGGGAGGTGGGGCTACCACATCTGCCCAGGTCATGGTGATCAAACGCCCTGGCAGAAAGCGAAAAGC
TGAAGCTGACCCCCAGGCCATTCCTAAGAAACGGGGTAGAAAGCCTGGGAGTGTGGTGGCAGCTGCTGCA
GCTGAGGCCAAAAAGAAAGCCGTGAAGGAGTCTTCCATACGGTCTGTGCATGAGACTGTGCTCCCCATCA
AGAAGCGCAAGACCCGGGAGACGGTCAGCATCGAGGTCAAGGAAGTGGTGAAGCCCCTGCTGGTGTCCAC
CCTTGGTGAGAAAAGCGGGAAGGGACTGAAGACCTGCAAGAGCCCTGGGCGTAAAAGCAAGGAGAGCAGC
CCCAAGGGGCGCAGCAGCAGTGCCTCCTCCCCACCTAAGAAGGAGCACCATCATCACCACCATCACTCAG
AGTCCACAAAGGCCCCCATGCCACTGCTCCCATCCCCACCCCCACCTGAGCCTGAGAGCTCTGAGGACCC
CATCAGCCCCCCTGAGCCTCAGGACTTGAGCAGCAGCATCTGCAAAGAAGAGAAGATGCCCCGAGGAGGC
TCACTGGAAAGCGATGGCTGCCCCAAGGAGCCAGCTAAGACTCAGCCTATGGTCGCCACCACTACCACAG
TTGCAGAAAAGTACAAACACCGAGGGGAGGGAGAGCGCAAAGACATTGTTTCATCTTCCATGCCAAGGCC
AAACAGAGAGGAGCCTGTGGACAGCCGGACGCCCGTGACCGAGAGAGTTAGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR207745 protein sequence
Red=Cloning site Green=Tags(s)

MVAGMLGLREEKSEDQDLQGLRDKPLKFKKAKKDKKEDKEGKHEPLQPSAHHSAEPAEAGKAETSESSGS
APAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIA
YFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTGRPKAAASEGVQVK
RVLEKSPGKLVVKMPFQASPGGKGEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAA
AEAKKKAVKESSIRSVHETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESS
PKGRSSSASSPPKKEHHHHHHHSESTKAPMPLLPSPPPPEPESSEDPISPPEPQDLSSSICKEEKMPRGG
SLESDGCPKEPAKTQPMVATTTTVAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_010788
ORF Size 1452 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_010788.4, NP_034918.1
RefSeq Size 10576 bp
RefSeq ORF 1455 bp
Locus ID 17257
UniProt ID Q9Z2D6
Cytogenetics X 37.63 cM
MW 52.3 kDa
Summary Chromosomal protein that binds to methylated DNA. It can bind specifically to a single methyl-CpG pair. It is not influenced by sequences flanking the methyl-CpGs. Mediates transcriptional repression through interaction with histone deacetylase and the corepressor SIN3. Binds both 5-methylcytosine (5mC) and 5-hydroxymethylcytosine (5hmC)-containing DNA, with a preference for 5-methylcytosine (5mC).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_010788" in other vectors (4)
SKU Description Size Price
MC216635 Mecp2 (untagged) - Mouse methyl CpG binding protein 2 (Mecp2), transcript variant 2, (10ug) 10 ug
$503.00
MG207745 Mecp2 (tGFP-tagged) - Mouse methyl CpG binding protein 2 (Mecp2), transcript variant 2 10 ug
$657.00
MR207745L3 Lenti ORF clone of Mecp2 (Myc-DDK-tagged) - Mouse methyl CpG binding protein 2 (Mecp2), transcript variant 2 10 ug
$757.00
MR207745L4 Lenti ORF clone of Mecp2 (mGFP-tagged) - Mouse methyl CpG binding protein 2 (Mecp2), transcript variant 2 10 ug
$757.00

Plasmid Map for MR207745

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR207745
Circular map for MR207745

file-alt Citations

Mecp2 fine-tunes quiescence exit by targeting nuclear receptors
Yang, Zou, Qiu et al
Elife (2024) 12 DOI: 10.7554/eLife.89912
AI Summary: OriGene products, specifically the Mecp2 Mouse Tagged ORF Clone (transcript variant 1, Cat# MR226839 and transcript variant 2, Cat# MR207745), were utilized in this study to investigate the role of Mecp2 in regulating quiescence exit and tissue regeneration.
Snippet: Cat #8454;RRID:Addgene_8454 Recombinant DNA reagent AAV8-TBG-MeCP2 Genechem Co., Ltd GOSV0233517 Recombinant DNA reagent Mecp2 Mouse Tagged ORF Clone, transcript variant 1 OriGene Cat# MR226839 Recombinant DNA reagent Mecp2 Mouse Tagged ORF Clone, transcript variant 2 OriGene Cat# MR207745 Recombinant DNA reagent Nedd4 Mouse Tagged ORF Clone Or
FigureFigureFigure
Mecp2 Fine-tunes Quiescence Exit by Targeting Nuclear Receptors
Yang, Zou, Qiu et al
A (2023) A (A), A DOI: 10.1101/2023.07.24.550263
Snippet: … Here, we show that methyl-CpG binding protein 2 (Mecp2) Save;NIH3T3 cells were transfected with Mecp2 (Origene, CA, USA, #MR226839, #MR207745) or Nedd4 (Origene, CA, USA, #MR222243) plasmid using Lipofectamine 3000 in serum-free medium for 12 h, then the medium was removed and replaced with DMEM containing 10% FBS for 24 h
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products