OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Sephs2 (NM_009266) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR207218
Txnrd1 (Myc-DDK-tagged) - Mouse thioredoxin reductase 1 (Txnrd1), transcript variant 4, (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA319460 Anti-Selenophosphate Synthetase 2 (SPS2) (RABBIT) Antibody, 100 ug
100 ug
$870.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Sephs2 or NM_009266"

Specifications
Specifications
Product Data
Type Mouse Untagged ORF Clone
Target Symbol Sephs2
Synonyms S; Sps2; Ysg; Ysg3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR207218 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGAAGCGGCGGCGGCGGGCGCCAGCGGAGAAACCATGGCGGCGCTAGTGGCCGCAGAAGGTTCCT
TGGGCCCGGCGGGCTGGTCTGCCGGCCGGAGTTTCTCCAACTACCGGCCGTTCGAGCCCCAGACACTGGG
CTTCAGCCCGAGCTGGCGGCTGACGAGCTTCTCCGGCATGAAGGGCTGAGGCTGCAAGGTCCCCCAGGAG
ACCCTGCTCAAACTCCTGGAGGGACTGACGCGGCCCGCGCTGCAGCCCCCGCTTACCTCGGGTCTGGTCG
GGGGCCAGGAAGAGACGGTGCAGGAAGGGGGCCTGTCCACCAGGCCCGGCCCCGGCTCAGCCTTCCCCTC
GCTGAGCATTGGCATGGACTCCTGCGTCATCCCCCTGAGGCACGGAGGCCTGTCGCTGGTGCAGACCACC
GACTTCTTTTACCCCTTGGTGGAAGATCCCTATATGATGGGGCGCATAGCTTGTGCCAATGTGCTCAGTG
ACCTCTATGCCATGGGTATCACTGAGTGTGACAACATGTTGATGTTACTCAGTGTGAGCCAGAGCATGAG
TGAAAAGGAACGAGAGAAGGTGACACCGCTCATGATCAAAGGCTTTCGTGACGCTGCGGAGGAGGGAGGC
ACTGCAGTGACCGGTGGACAGACAGTGGTCAACCCGTGGATTATCATCGGTGGCGTTGCCACGGTGGTGT
GTCAGCAAAATGAATTCATAATGCCTGATAGTGCCGTGGTAGGAGATGTGCTGGTATTAACCAAACCTTT
AGGAACCCAGGTTGCTGCCAATGCCCACCAATGGCTGGATAATCCTGAGAAATGGAATAAAATCAAGATG
GTGGTTTCCAGAGAGGAAGTAGAGTTAGCCTATCAGGAAGCTATGTTCAATATGGCTACTCTAAACAGGA
CTGCTGCTGGCTTGATGCACACTTTTAATGCCCACGCAGCCACGGATATCACAGGCTTTGGCATATTAGG
ACACTCTCAGAACCTGGCAAAACAGCAAAAAAATGAAGTGTCCTTTGTCATACATAATCTGCCAATAATT
GCCAAGATGGCTGCGATCAGCAAAGCCAGTGGGCGCTTTGGCCTCCTCCAAGGAACGTCAGCTGAAACCT
CTGGGGGATTACTGATTTGTCTGCCAAGAGAGCAGGCGGCCCGCTTTTGTTCGGAAATCAAATCTTCCAA
GTACGGAGAGGGTCACCAAGCTTGGATCGTTGGCATCGTGGAGAAGGGAAACCGGACAGCCCGGATCATT
GACAAGCCTCGCGTTATTGAAGTTCTACCTCGGGGAGCCTCTGCTGCTGCTGCTGCTGCTCCTGATAATT
CCAACGCAGCCTCTGAGCCTAGTTCT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR207218 protein sequence
Red=Cloning site Green=Tags(s)

MAEAAAAGASGETMAALVAAEGSLGPAGWSAGRSFSNYRPFEPQTLGFSPSWRLTSFSGMKG*GCKVPQE
TLLKLLEGLTRPALQPPLTSGLVGGQEETVQEGGLSTRPGPGSAFPSLSIGMDSCVIPLRHGGLSLVQTT
DFFYPLVEDPYMMGRIACANVLSDLYAMGITECDNMLMLLSVSQSMSEKEREKVTPLMIKGFRDAAEEGG
TAVTGGQTVVNPWIIIGGVATVVCQQNEFIMPDSAVVGDVLVLTKPLGTQVAANAHQWLDNPEKWNKIKM
VVSREEVELAYQEAMFNMATLNRTAAGLMHTFNAHAATDITGFGILGHSQNLAKQQKNEVSFVIHNLPII
AKMAAISKASGRFGLLQGTSAETSGGLLICLPREQAARFCSEIKSSKYGEGHQAWIVGIVEKGNRTARII
DKPRVIEVLPRGASAAAAAAPDNSNAASEPSS

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_009266
ORF Size 1356 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins.
OTI Annotation This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_009266.3
RefSeq Size 2206 bp
RefSeq ORF 1359 bp
Locus ID 20768
UniProt ID P97364
Cytogenetics 7 69.43 cM
Summary This gene encodes an enzyme that catalyzes the production of monoselenophosphate (MSP) from selenide and ATP. MSP is the selenium donor required for synthesis of selenocysteine (Sec), which is co-translationally incorporated into selenoproteins at in-frame UGA codons that normally signal translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the Sec insertion sequence (SECIS) element, which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This protein is itself a selenoprotein containing a Sec residue at its active site, suggesting the existence of an autoregulatory mechanism. It is preferentially expressed in tissues implicated in the synthesis of selenoproteins and in sites of blood cell development. provided by RefSeq, May 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_009266" in other vectors (3)
SKU Description Size Price
MC203276 Sephs2 (untagged) - Mouse selenophosphate synthetase 2 (Sephs2), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) 10 ug
$242.00
MG207218 Sephs2 (GFP-tagged) - Mouse selenophosphate synthetase 2 (Sephs2), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) 10 ug
$657.00
MR207225 Txnrd2 (Myc-DDK-tagged) - Mouse thioredoxin reductase 2 (Txnrd2), nuclear gene encoding mitochondrial protein, (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) 10 ug
$477.00

Plasmid Map for MR207218

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR207218
Circular map for MR207218

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products