OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Micu2 (NM_028643) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR206892
Efha1 (Myc-DDK-tagged) - Mouse EF hand domain family A1 (Efha1)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Micu2 or NM_028643"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Micu2
Synonyms 1110008L20Rik; 4833427E09Rik; AU041871; Efha1; Smhs2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR206892 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGCTGCGGGAAGAAGCGCTTGGCTGGCGGCCTGGGGCGGAAGGCTGCGGCGCGGGCTCGCGG
CCGGCCGACGAGCTGTGCCGACTCGCGGCCCTCTCGCAGCGGCTGTGGCCGGGGTAGCCCTGGCAGGCGC
AGGAGCGGCATGGCATCACGGCCGCGTGAAAGCAGCCGCGCGCGAGGGCTCCCGAACGGTGTCGGCGCAG
AAAAATTATTTGGGACCAATAGAGAAACTTTCTCTCCGCAAACAGCGGTTCATGCAGTTTTCATCCCTGG
AGCACGACGGAGAGTATTACATGACACCCCGAGACTTCCTCTTCTCAGTCATGTTTGAGCAAGTGGAGCG
TAAAACACTGGTCAAGAAGCTGGCAAAAAAGGATATCGAGGATGTACTGTCAGGAATCCAAACAGCACGC
TGTGGATCAACATTTTTTAGAGACCTGGGTGATAAAGGGGTAATTTCATATACCGAGTATCTTTTCTTGC
TTACAATCCTCACAAAACCTCACTCTGGGTTCCATGTTGCTTTTAAAATGCTGGATGTGGATGGGAATGA
GATGATCGAGAGGAAGGAGTTTGTTAAGCTGCAGAAGATCATAAGTAAACAAGATGGCTTCAAGACAGTG
AAGACTAATGAGACAGAATACCAGGACCCAACAGTGAAAGAGCCTGGCGTTAACACAACCCTTCAAGTGC
GTTTCTTTGGGAAAAGAGGAGAAAAAAAACTCCATTATAAAGAATTTCGAAGATTTATGGAAAATTTACA
AACAGAAGTTCAAGAAATGGAATTCCTTCAGTTCTCTAAAGGCCTGAATTTCATGAGAAAAGAAGACTTT
GCAGAATGGCTACTTTTCTTCACTAACACTGAAAATAAAGATATTTACTGGAGAAACGTGAGAGAAAAGT
TGTCAGTAGGAGAGAGCATTAGTTTGGATGAGTTCAAGTCCTTTTGCCATTTTACAACGCATTTGGAAGA
CTTTGCTATCGCCATGCAAATGTTTAGTTTAGCTCATCGCCCTGTGCGGCTGGCAGAGTTCAAGAGAGCT
GTGAAGGTAGCGACTGGACAGGAGCTCTCGGACAATCTTCTGGACACCGTCTTCAAGATCTTTGACCTGG
ACGGGGACGAGTGCCTCAGCCACGGCGAGTTCCTTGGGGTACTGAAAAACAGGATGCACCGAGGCTTATG
GGTGTCACAGCAGCAGAGTGTGCAAGAATACTGGAAGTGTGTGAAGAAGGAAAGCATCAAGGGAGTAAAG
GAAGCCTGGAGACAACAAGCCGGCAAGGGCCCCTTC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR206892 protein sequence
Red=Cloning site Green=Tags(s)

MAAAAGRSAWLAAWGGRLRRGLAAGRRAVPTRGPLAAAVAGVALAGAGAAWHHGRVKAAAREGSRTVSAQ
KNYLGPIEKLSLRKQRFMQFSSLEHDGEYYMTPRDFLFSVMFEQVERKTLVKKLAKKDIEDVLSGIQTAR
CGSTFFRDLGDKGVISYTEYLFLLTILTKPHSGFHVAFKMLDVDGNEMIERKEFVKLQKIISKQDGFKTV
KTNETEYQDPTVKEPGVNTTLQVRFFGKRGEKKLHYKEFRRFMENLQTEVQEMEFLQFSKGLNFMRKEDF
AEWLLFFTNTENKDIYWRNVREKLSVGESISLDEFKSFCHFTTHLEDFAIAMQMFSLAHRPVRLAEFKRA
VKVATGQELSDNLLDTVFKIFDLDGDECLSHGEFLGVLKNRMHRGLWVSQQQSVQEYWKCVKKESIKGVK
EAWRQQAGKGPF

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_028643
ORF Size 1296 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_028643.3
RefSeq Size 2310 bp
RefSeq ORF 1299 bp
Locus ID 68514
UniProt ID Q8CD10
Cytogenetics 14 C3
MW 49.5 kDa
Summary Key regulator of mitochondrial calcium uniporter (MCU) required to limit calcium uptake by MCU when cytoplasmic calcium is low (PubMed:23409044, PubMed:24560927). MICU1 and MICU2 form a disulfide-linked heterodimer that stimulate and inhibit MCU activity, depending on the concentration of calcium (PubMed:24560927). MICU2 acts as a gatekeeper of MCU that senses calcium level via its EF-hand domains: prevents channel opening at resting Ca(2+), avoiding energy dissipation and cell-death triggering (PubMed:24560927).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_028643" in other vectors (4)
SKU Description Size Price
MC201768 Micu2 (untagged) - Mouse EF hand domain family A1 (Efha1), (10ug) 10 ug
$457.00
MG206892 Efha1 (tGFP-tagged) - Mouse EF hand domain family A1 (Efha1) 10 ug
$657.00
MR206892L3 Lenti ORF clone of Efha1 (Myc-DDK-tagged) - Mouse EF hand domain family A1 (Efha1) 10 ug
$757.00
MR206892L4 Lenti ORF clone of Efha1 (mGFP-tagged) - Mouse EF hand domain family A1 (Efha1) 10 ug
$757.00

Plasmid Map for MR206892

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR206892
Circular map for MR206892

file-alt Citations

Asymmetric distribution of mitochondrial Ca2+ regulators specifies compartment-specific mitochondrial function and neuronal development
Jang, Kim, Kim et al
Experimental & Molecular Medicine (2026)
AI Summary: OriGene products MICU1 (MR207652) and MICU2 (MR206892) were used to generate expression constructs for studying the roles of these mitochondrial Ca2+ regulators in compartment-specific mitochondrial function and neuronal development.
Snippet: Control empty vector (pCAG) was generated by deleting IRES-GFP sequence from pCIG2. pCAG::MICU1-mTagBFP2 and pCAG::MICU1-mScarlet were created by inserting MICU1 (OriGene, MR207652). pCAG::MICU2-mTagBFP2 and pCAG::MICU2-mScarlet were created by inserting MICU2 (OriGene, MR206892) into pCAG vector
Asymmetric distribution of mitochondrial Ca2+ regulators specifies compartment-specific mitochondrial function and neuronal development
Jang, Kim, Kim et al
bioRxiv (2025)
Cited by 3
AI Summary: OriGene products MICU1 (MR207652) and MICU2 (MR206892) were used to generate expression constructs for investigating the role of these mitochondrial Ca2+ regulators in compartment-specific mitochondrial function and neuronal development.
Snippet: tor (pCAG::) was generated by deleting IRES-GFP sequence from pCIG2. pCAG::MICU1-mTagBFP2 and pCAG::MICU2-mTagBFP2 were created by inserting MICU1 (OriGene, MR207652) and MICU2 (OriGene, MR206892) into pCAG vector, respectively. Ex utero electroporation
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products