OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Fbxo5 (NM_025995) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR206701
Fbxo5 (Myc-DDK-tagged) - Mouse F-box protein 5 (Fbxo5)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Fbxo5 or NM_025995"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Fbxo5
Synonyms 2510044I10Rik; C85305; Emi1; Fbxo31
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR206701 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCCGGCGCACCTGCAGTGACCTGCGCCGGCCGTCCTCCTGTCCCTGCCGTCTTGGCGCGCGGACTA
CCGTGGACGGTTGTAAAGAAGAAAGCCCTGTTCTTTCTGTTACAATGAAGTGTTTTAATTGCAACCCTGA
TCTTTCCGAGCTTGAAGTGGTGAAGCCTGAGGACAGTGGGATAGAAGCTTCCTACAGTCCCGTGTGTTTG
GAACCTTCCTGTAATGACTGTGTTAGAAACCATGAGAGGTTGTCTTTCATCGACTCACCAATTGTGGGAC
ATGATAACAAGGAAAATCAACGCGTACAAAACACACTAGATAGTTCAAACGAAACAGAAGAGCTAGAGGC
CAGTAGACTGTATGAGGACAGTGGCTACTCATCTTTCACACAAAGTGACCGTGACGATGGCATCCTTATC
CTGGAGAATTTCAGAAACAGTCCCCAGGCCCGTCTGCTGCCATCACAGAGCCCGGACCAGCATCCCAACA
AAACCTTGCTGCCTGTCCTGCATTTTGAAAGAGTGGTTTGCTCAACACTAAAAAAGAATGGCAAGCGAAA
CCCTAAAGTGGATCGAGAAATGCTGAAGGAAGTTATTGCCAGCGGGAACTTTAGACTGCAAAATATAATT
GGCAAGAAAATGGGCCTGGAGCACCTAGACATCCTGGCTGAGCTCTCCCGCAGGGGATTCGTGCACCTGT
TGGCTAACATTTTGACTAAGCTCAGCGGCATGGACTTAGTAAATCTGTCTAAAGTGAGCAGAATTTGGAA
GAAGATACTGGAAAACAATAAGGGGGCGTTCCAGCTCTACAGCAAAACCATGCAGCGAGTCATTGAAAGC
AGTAAGTTGTCACTACATGCTACAACGAGAGGATATGTTGTGGGCAGAGCTGCACTAACTTGTGTTCAAA
AGTCATCGACCTGGGCACCTCCCAAAAAAGATGTTCAAATCAAGTCCTCCAGTCAGCGTGGTCAGAGAGT
TTCTACCTACAGCCGGCACAATGAGTTCGTGGAGGTGGCAAAGACATTGAAGAACAACGAAAGCCTCAAA
GCCTGTGTTCGCTGTAATTTCCCTGCAAAATATGACCACTATTTAGAGCGAGCAGTCTGCAAACGGGAAA
GCTGTCAATTTGAATATTGTACAAAGTGTCTGTGTGCTTACCATAACAACAAAGACTGTTTGAATGGCAA
GATCCTAAAAGCCAGCTGTAAAGTGGGTCCTTTGCCTGGAACTAAAAAGAGTAAAAAGAACTTACAAAGA
TTG

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR206701 protein sequence
Red=Cloning site Green=Tags(s)

MSRRTCSDLRRPSSCPCRLGARTTVDGCKEESPVLSVTMKCFNCNPDLSELEVVKPEDSGIEASYSPVCL
EPSCNDCVRNHERLSFIDSPIVGHDNKENQRVQNTLDSSNETEELEASRLYEDSGYSSFTQSDRDDGILI
LENFRNSPQARLLPSQSPDQHPNKTLLPVLHFERVVCSTLKKNGKRNPKVDREMLKEVIASGNFRLQNII
GKKMGLEHLDILAELSRRGFVHLLANILTKLSGMDLVNLSKVSRIWKKILENNKGAFQLYSKTMQRVIES
SKLSLHATTRGYVVGRAALTCVQKSSTWAPPKKDVQIKSSSQRGQRVSTYSRHNEFVEVAKTLKNNESLK
ACVRCNFPAKYDHYLERAVCKRESCQFEYCTKCLCAYHNNKDCLNGKILKASCKVGPLPGTKKSKKNLQR
L

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-RsrII Cloning Scheme for this gene | Plasmid Map
ACCN NM_025995
ORF Size 1263 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025995.2, NP_080271.2
RefSeq Size 1820 bp
RefSeq ORF 1266 bp
Locus ID 67141
UniProt ID Q7TSG3
Cytogenetics 10 A1
MW 47.5 kDa
Summary Regulator of APC activity during mitotic and meiotic cell cycle (PubMed:17190794, PubMed:15526037, PubMed:16809773). During mitotic cell cycle plays a role as both substrate and inhibitor of APC-FZR1 complex (PubMed:16809773). During G1 phase, plays a role as substrate of APC-FZR1 complex E3 ligase. Then switches as an inhibitor of APC-FZR1 complex during S and G2 leading to cell-cycle commitment. As APC inhibitor, prevents the degradation of APC substrates at multiple levels: by interacting with APC and blocking access of APC substrates to the D-box co-receptor, formed by FZR1 and ANAPC10; by suppressing ubiquitin ligation and chain elongation by APC by preventing the UBE2C and UBE2S activities. Plays a role in genome integrity preservation by coordinating DNA replication with mitosis through APC inhibition in interphase to stabilize CCNA2 and GMNN in order to promote mitosis and prevent rereplication and DNA damage-induced cellular senescence (By similarity). During oocyte maturation, plays a role in meiosis through inactivation of APC-FZR1 complex. Inhibits APC through RPS6KA2 interaction that increases FBXO5 affiniy for CDC20 leading to the metaphase arrest of the second meiotic division before fertilization (PubMed:15526037). Controls entry into the first meiotic division through inactivation of APC-FZR1 complex (PubMed:17190794). Promotes migration and osteogenic differentiation of mesenchymal stem cells (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_025995" in other vectors (4)
SKU Description Size Price
MC205910 Fbxo5 (untagged) - Mouse F-box protein 5 (Fbxo5), (10ug) 10 ug
$457.00
MG206701 Fbxo5 (tGFP-tagged) - Mouse F-box protein 5 (Fbxo5) 10 ug
$657.00
MR206701L3 Lenti ORF clone of Fbxo5 (Myc-DDK-tagged) - Mouse F-box protein 5 (Fbxo5) 10 ug
$757.00
MR206701L4 Lenti ORF clone of Fbxo5 (mGFP-tagged) - Mouse F-box protein 5 (Fbxo5) 10 ug
$757.00

Plasmid Map for MR206701

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR206701
Circular map for MR206701

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products