OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ap3m1 (BC024595) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR206629
Ap3m1 (Myc-DDK-tagged) - Mouse adaptor-related protein complex 3, mu 1 subunit (cDNA clone MGC:30415 IMAGE:5026206)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Ap3m1 or BC024595"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ap3m1
Synonyms 1200013D09Rik; C78982; R75378
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR206629 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCCACAGTCTATTTCTCATAAACTGCTCTGGCGACATTTTTCTAGAAAAACACTGGAAGAGCGTTG
TAAGCCAGTCAGTGTGTGACTATTTCTTTGAAGCTCAGGAGAAAGCTGCTGATGTTGAAAATGTCCCACC
TGTCATTTCAACACCTCACCACTACCTCATTAGTATCTACCGGGATAAGCTCTTCTTTGTGTCTGTGATA
CAGACCGAAGTGCCACCTCTCTTTGTAATTGAATTTCTGCATCGAGTTGCTGACACTTTTCAGGACTACT
TTGGTGAGTGTTCAGAGGCTGCAATTAAGGATAATGTGGTCATAGTATATGAGCTCTTGGAAGAAATGTT
AGACAATGGATTCCCACTGGCTACTGAATCTAACATTTTGAAAGAACTGATTAAACCACCAACAATTCTA
CGTTCTGTCGTCAATTCTATTACAGGCAGTAGTAATGTTGGGGATACACTCCCCACTGGGCAGCTATCCA
ACATCCCATGGCGTCGAGCAGGAGTGAAGTACACAAACAATGAAGCCTATTTTGATGTAGTTGAAGAGAT
AGATGCAATTATAGATAAATCAGGATCTACAGTCTTTGCAGAAATTCAAGGGGTCATTGATGCTTGCATT
AAGCTGTCTGGAATGCCTGATCTCTCCCTCTCTTTCATGAACCCAAGGCTACTAGATGACGTCAGCTTCC
ACCCATGCATCCGATTCAAACGCTGGGAGTCTGAAAGAGTTTTGTCATTCATTCCTCCAGATGGAAATTT
CCGACTCATATCGTATCGTGTCAGCTCACAAAATCTAGTGGCAATACCAGTGTATGTGAAACACAGTATC
AGCTTTAAGGAAAACAGCTCTTGTGGCCGGTTTGATATAACAATTGGACCGAAACAGAATATGGGAAAAA
CAATTGAAGGAATCACAGTGACTGTTCACATGCCCAAAGTTGTGCTGAATATGAACCTGACACCAACGCA
AGGCAGCTATACATTTGATCCCGTGACCAAGGTACTAGCATGGGATGTGGGCAAAATTACTCCACAAAAG
CTCCCAAGTCTTAAAGGACTAGTAAATTTACAGTCAGGAGCACCCAAGCCAGAAGAGAACCCAAACCTCA
ACATACAGTTCAAGATCCAGCAGCTTGCTATTTCAGGCTTAAAAGTGAACCGCTTGGACATGTATGGTGA
GAAGTATAAGCCATTTAAAGGAGTCAAATATGTCACAAAGGCTGGGAAGTTCCAAGTGAGGACA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR206629 protein sequence
Red=Cloning site Green=Tags(s)

MIHSLFLINCSGDIFLEKHWKSVVSQSVCDYFFEAQEKAADVENVPPVISTPHHYLISIYRDKLFFVSVI
QTEVPPLFVIEFLHRVADTFQDYFGECSEAAIKDNVVIVYELLEEMLDNGFPLATESNILKELIKPPTIL
RSVVNSITGSSNVGDTLPTGQLSNIPWRRAGVKYTNNEAYFDVVEEIDAIIDKSGSTVFAEIQGVIDACI
KLSGMPDLSLSFMNPRLLDDVSFHPCIRFKRWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHSI
SFKENSSCGRFDITIGPKQNMGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLAWDVGKITPQK
LPSLKGLVNLQSGAPKPEENPNLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYVTKAGKFQVRT

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN BC024595
ORF Size 1254 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC024595, AAH24595
RefSeq Size 2157 bp
RefSeq ORF 1256 bp
Locus ID 55946
Cytogenetics 14 11.58 cM
MW 46.9 kDa
Summary Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"BC024595" in other vectors (3)
SKU Description Size Price
MG206629 Ap3m1 (tGFP-tagged) - Mouse adaptor-related protein complex 3, mu 1 subunit (cDNA clone MGC:30415 IMAGE:5026206) 10 ug
$657.00
MR206629L3 Lenti ORF clone of Ap3m1 (Myc-DDK-tagged) - Mouse adaptor-related protein complex 3, mu 1 subunit (cDNA clone MGC:30415 IMAGE:5026206) 10 ug
$757.00
MR206629L4 Lenti ORF clone of Ap3m1 (mGFP-tagged) - Mouse adaptor-related protein complex 3, mu 1 subunit (cDNA clone MGC:30415 IMAGE:5026206) 10 ug
$757.00

Plasmid Map for MR206629

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR206629
Circular map for MR206629

file-alt Citations

Amyloid-like aggregating proteins cause lysosomal defects in neurons via gain-of-function toxicity
Riera-Tur, Schäfer, Hornburg et al
Life Sci Alliance (2022) 5 (3) DOI: 10.26508/lsa.202101185
Cited by 28
AI Summary: OriGene's mouse AP-3μ1 expression plasmid (Ref. MR206629) was used in this study to restore AP-3μ1 levels in neurons, enabling the authors to demonstrate that replenishing AP-3μ1 ameliorates lysosomal defects and neurotoxicity caused by amyloid-like aggregating proteins.
Snippet: pmCherry-N1 was used as control. The mouse AP-3μ1 expression plasmid was purchased from OriGene (Ref. MR206629) and consists of AP-3μ1-myc-DDK in pCMV6-ENTRY. For interactome analysis, myc-mCherry, myc-β4-mCherry, myc-β17-mCherry, and myc-β23-mCherry were cloned into pENTR1A-164 between restriction sites NotI and
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products