OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Tead2 (BC050217) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR206438
Tead2 (Myc-DDK-tagged) - Mouse TEA domain family member 2 (cDNA clone MGC:60551 IMAGE:30021393)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA363195 TEAD2 Antibody - N-terminal region
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Tead2 or BC050217"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Tead2
Synonyms ETF, TEF4, TEAD-2, TEF-4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR206438 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGGATCCCCGGACTGGGGCCCCCCTGGATGATGGCGGGGGCTGGACAGGTAGCGAGGAAGGCAGCG
AAGAGGGCACCGGAGGCAGCGAGGGCGTTGGAGGTGATGGCAGCCCTGATGCAGAAGGCCGGAACGAACT
CATTGCCCGTTACATCAAGCTGAGGACAGGGAAGACGAGAACGCGAAAGCAGGTCTCCAGCCATATTCAG
GTTTTGGCTCGAAGGAAATCGAGAGAAATTCAGTCCAAGCTGAAGGACCAAGTCTCCAAGGACAAGGCCT
TCCAGACGATGGCCACCATGTCTTCGGCACAGCTCATCTCCGCCCCTTCCCTCCAGGCCAAGCTGGGCCC
TTCTGGCCCTCAGGCCACTGAGCTTTTCCAGTTCTGGTCAGGGAGCTCTGGGCCACCATGGAATGTTCCA
GACGTGAAGCCCTTCTCACAGGCACCGTTCTCCGTGTCACTGACGCCCCCAGCCTCTGACCTACCAGGGT
ACGAGCCGCCCCCAGCCCTCTCACCCCTGCCCCCACCCGCTCCGTCTCCCCCAGCCTGGCAGGCTCGGGC
CCTGGGCACTGCCCGCCTGCAGCTGATAGAGTTCTCAGCGTTTGTGGAACCGCCAGACGCAGTTGACTCG
TTCCAGAGGCATCTGTTTGTCCACATCAGTCAGCAGTGTCCCAGCCCTGGAGCACCACCCCTAGAGAGTG
TGGACGTGCGGCAGATCTACGACAAATTCCCTGAGAAGAAGGGCGGCCTCCGCGAGCTGTATGACCGAGG
GCCACCACATGCCTTCTTCCTCGTCAAGTTCTGGGCGGACCTGAACTGGGGCCCCAGTGCCGAGGAGGCA
GGGAGCAGCGGAGGTGGCGGTGGCTTCTATGGAGTGAGCAGCCAGTATGAGAGCCGGGAGCTCATGACAC
TCACCTGCTCCTCCAAGGTCTGCTCCTTTGGCAAGCAAGTGGTAGAGAAGGTGGAGACGGAACGGGCCCA
GCTGGAGGACGGGCGCTTTGTGTACCGTCTGCTGCGCTCTCCCATGTGTGAGTACCTGGTTAATTTCCTG
CACAAGCTCCGTCAGCTGCCTGAACGCTACATGATGAACAGTGTCCTGGAGAACTTCACCATCCTCCAGG
TTGTGACAAACAGGGACACTCAGGAACTGCTGCTGTGTACTGCCTACGTCTTTGAAGTCTCCACCAGTGA
ACGAGGAGCCCAGTACCACATCTACCGCCTGGTCAGGGAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR206438 protein sequence
Red=Cloning site Green=Tags(s)

MGDPRTGAPLDDGGGWTGSEEGSEEGTGGSEGVGGDGSPDAEGRNELIARYIKLRTGKTRTRKQVSSHIQ
VLARRKSREIQSKLKDQVSKDKAFQTMATMSSAQLISAPSLQAKLGPSGPQATELFQFWSGSSGPPWNVP
DVKPFSQAPFSVSLTPPASDLPGYEPPPALSPLPPPAPSPPAWQARALGTARLQLIEFSAFVEPPDAVDS
FQRHLFVHISQQCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHAFFLVKFWADLNWGPSAEEA
GSSGGGGGFYGVSSQYESRELMTLTCSSKVCSFGKQVVEKVETERAQLEDGRFVYRLLRSPMCEYLVNFL
HKLRQLPERYMMNSVLENFTILQVVTNRDTQELLLCTAYVFEVSTSERGAQYHIYRLVRD

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN BC050217
ORF Size 1230 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC050217, AAH50217
RefSeq Size 1951 bp
RefSeq ORF 1232 bp
Locus ID 21677
Cytogenetics 7 29.19 cM
MW 45.1 kDa
Summary Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction (By similarity). Binds to the SPH and GT-IIC 'enhansons' (5'-GTGGAATGT-3'). May be involved in the gene regulation of neural development. Binds to the M-CAT motif.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"BC050217" in other vectors (4)
SKU Description Size Price
MC217755 Tead2 (untagged) - Mouse TEA domain family member 2 (cDNA clone MGC:60551 IMAGE:30021393), (10ug) 10 ug
$503.00
MG206438 Tead2 (tGFP-tagged) - Mouse TEA domain family member 2 (cDNA clone MGC:60551 IMAGE:30021393) 10 ug
$657.00
MR206438L3 Lenti ORF clone of Tead2 (Myc-DDK-tagged) - Mouse TEA domain family member 2 (cDNA clone MGC:60551 IMAGE:30021393) 10 ug
$757.00
MR206438L4 Lenti ORF clone of Tead2 (mGFP-tagged) - Mouse TEA domain family member 2 (cDNA clone MGC:60551 IMAGE:30021393) 10 ug
$757.00

Plasmid Map for MR206438

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR206438
Circular map for MR206438

file-alt Citations

A TEAD2-driven endothelial-like program shapes basal-like differentiation and metastasis of pancreatic cancer
Yoo, Moon, Kim et al
Gastroenterology (2023)
Cited by 15
AI Summary: OriGene’s TEAD2 wild-type cDNA (Cat# MR206438) was used for overexpression experiments to investigate the role of TEAD2 in basal-like pancreatic cancer cell differentiation and metastasis.
Snippet: For the overexpression experiment, mouse Tead2 DN (from TEAD2 wild-type cDNA, Cat# MR206438, Origene, Maryland, United States) were subcloned into retroviral vectors (MSCV-neo, Addgene #105505, Massachusetts, United States)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products