OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ugcg (NM_011673) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR206157
Ugcg (Myc-DDK-tagged) - Mouse UDP-glucose ceramide glucosyltransferase (Ugcg)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Ugcg or NM_011673"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ugcg
Synonyms AU043821; C80537; Epcs21; GlcT-1; Ugcgl
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR206157 representing NM_011673
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCTGCTGGACCTGGCCCAGGAGGGAATGGCCTTGTTCGGCTTCGTGCTCTTCGTGGTGCTGTGGC
TGATGCATTTCATGTCCATCATCTACACCCGGTTACACCTCAACAAGAAGGCAACAGACAAACAGCCGTA
TAGCAAGCTCCCTGGTGTCTCTCTTCTGAAGCCACTGAAGGGGGTGGATCCTAACCTAATCAACAACTTG
GAGACATTCTTTGAACTGGATTATCCCAAATATGAAGTACTCCTTTGTGTACAAGATCATGATGATCCAG
CCATTGATGTATGTAAGAAATTGCTTGGAAAATACCCAAATGTCGATGCTAGATTATTTATAGGTGGCAA
AAAGGTTGGCATTAACCCTAAAATTAATAATTTGATGCCAGCATATGAAGTTGCAAAATATGATCTCATA
TGGATTTGTGATAGCGGAATAAGAGTCATCCCAGACACATTAACTGACATGGTGAATCAGATGACAGAGA
AAGTGGGGTTGGTCCACGGGCTGCCGTATGTAGCCGACAGACAAGGCTTTGCTGCCACCTTAGAGCAGGT
ATATTTTGGAACTTCACACCCAAGATCCTATATCTCTGCCAATGTAACTGGCTTCAAATGTGTGACGGGG
ATGTCTTGTTTGATGAGGAAGGATGTGCTAGATCAGGCAGGAGGGCTCATAGCCTTTGCTCAGTACATTG
CTGAAGATTACTTTATGGCCAAAGCAATAGCCGACCGAGGTTGGAGGTTTTCAATGTCTACTCAAGTTGC
CATGCAAAACTCTGGTTCGTACTCAATTTCTCAGTTTCAATCCAGAATGATCAGGTGGACCAAATTGAGA
ATTAACATGCTTCCTGCTACAATAATTTGTGAGCCAATTTCAGAATGCTTTGTTGCCAGTTTAATTATTG
GGTGGGCAGCCCACCATGTATTCAGATGGGATATCATGGTCTTCTTCATGTGCCACTGCCTGGCATGGTT
TATATTTGACTACATTCAACTCAGGGGTGTCCAGGGTGGCACACTGTGTTTTTCAAAACTTGATTATGCT
GTGGCCTGGTTCATCCGTGAATCCATGACAATCTACATTTTCCTGTCGGCATTATGGGACCCGACTATAA
GCTGGAGAACTGGTCGCTACAGGTTACGCTGTGGGGGGACAGCAGAGGAGATCCTGGATGTG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR206157 representing NM_011673
Red=Cloning site Green=Tags(s)

MALLDLAQEGMALFGFVLFVVLWLMHFMSIIYTRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNL
ETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPAYEVAKYDLI
WICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGFAATLEQVYFGTSHPRSYISANVTGFKCVTG
MSCLMRKDVLDQAGGLIAFAQYIAEDYFMAKAIADRGWRFSMSTQVAMQNSGSYSISQFQSRMIRWTKLR
INMLPATIICEPISECFVASLIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYA
VAWFIRESMTIYIFLSALWDPTISWRTGRYRLRCGGTAEEILDV

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_011673
ORF Size 1182 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_011673.2
RefSeq Size 3719 bp
RefSeq ORF 1185 bp
Locus ID 22234
UniProt ID O88693
Cytogenetics 4 B3
MW 45.3 kDa
Summary Catalyzes at the cytosolic surface of the Golgi, the initial step of the glucosylceramide-based glycosphingolipid/GSL synthetic pathway, the transfer of glucose from UDP-glucose to ceramide to produce glucosylceramide/GlcCer (PubMed:10430909, PubMed:16109770, PubMed:28373486). Glucosylceramide is the core component of glycosphingolipids/GSLs, amphipathic molecules consisting of a ceramide lipid moiety embedded in the outer leaflet of the membrane, linked to one of hundreds of different externally oriented oligosaccharide structures (PubMed:10430909). Glycosphingolipids are essential components of membrane microdomains that mediate membrane trafficking and signal transduction (PubMed:10430909). They are implicated in many fundamental cellular processes, including growth, differentiation, migration, morphogenesis, cell-to-cell and cell-to-matrix interactions (PubMed:10430909). They are required for instance in the proper development and functioning of the nervous system (PubMed:16109770). As an example of their role in signal transduction, they regulate the leptin receptor/LEPR in the leptin-mediated signaling pathway (PubMed:23554574). They also play an important role in the establishment of the skin barrier regulating keratinocyte differentiation and the proper assembly of the cornified envelope (PubMed:17145749, PubMed:23748427). The biosynthesis of GSLs is also required for the proper intestinal endocytic uptake of nutritional lipids (PubMed:22851168).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_011673" in other vectors (4)
SKU Description Size Price
MC209618 Ugcg (untagged) - Mouse UDP-glucose ceramide glucosyltransferase (Ugcg), (10ug) 10 ug
$686.00
MG206157 Ugcg (tGFP-tagged) - Mouse UDP-glucose ceramide glucosyltransferase (Ugcg) 10 ug
$489.00 $657.00
MR206157L3 Lenti ORF clone of Ugcg (Myc-DDK-tagged) - Mouse UDP-glucose ceramide glucosyltransferase (Ugcg) 10 ug
$757.00
MR206157L4 Lenti ORF clone of Ugcg (mGFP-tagged) - Mouse UDP-glucose ceramide glucosyltransferase (Ugcg) 10 ug
$757.00

Plasmid Map for MR206157

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR206157
Circular map for MR206157

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products