OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Dpf1 (NM_013874) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR206060
Dpf1 (Myc-DDK-tagged) - Mouse D4, zinc and double PHD fingers family 1 (Dpf1)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Dpf1 or NM_013874"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Dpf1
Synonyms Neud4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR206060 representing NM_013874
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACCGCCATTCAGAACCCGCTCAAGTCCCTTGGCGAGGACTTCTACCGGGAGGCCATCGAGCACT
GTCGCAGCTACAACGCGCGCCTGTGTGCCGAGCGCAGCCTGCGCCTGCCTTTCCTCGACTCGCAGACCGG
AGTGGCCCAGAACAACTGCTACATCTGGATGGAGAAGACCCACCGCGGGCCTGGTTTGGCCCCGGGACAG
ATCTACACTTACCCCGCCCGCTGTTGGAGGAAGAAACGGAGACTCAACATCCTGGAGGACCCCAGGCTCC
GGCCCTGCGAGTACAAGATCGATTGTGAGGCACCTCTGAAGAAGGAGGGTGGCCTCCCGGAAGGGCCAGT
CCTCGAGGCTCTGCTGTGTGCTGAGACTGGAGAGAAGAAAGTGGAGCTGAAGGAGGAGGAGACCATCATG
GACTGTCAGAAACAGCAGTTGCTGGAGTTTCCGCATGATCTCGAGGTAGAAGACTTGGAGGAAGACATTC
CCAGGAGGAAGAACAGGGCAAGAGGAAAGGCATATGGCATTGGAGGTCTCCGCAAACGCCAGGACACCGC
ATCCCTGGAGGACCGAGACAAGCCGTACGTCTGTGATATCTGTGGGAAGAGATATAAGAACCGGCCAGGA
CTCAGCTACCATTACACCCACACCCACCTGGCTGAGGAGGAGGGGGAGGAGCACACTGAACGCCACGCCC
TGCCTTTCCACCGGAAAAACAACCATAAACAGTTTTACAAAGAATTGGCCTGGGTCCCCGAGGCACAGAG
GAAACACACAGCCAAGAAAGCACCAGATGGCACTGTCATCCCCAATGGCTACTGTGACTTTTGCCTGGGG
GGCTCCAAGAAGACTGGGTGTCCCGAGGACCTCATCTCCTGTGCGGACTGTGGGCGATCAGGACATCCCT
CGTGTTTACAGTTCACGGTGAACATGACCGCGGCTGTGCGGACCTACCGCTGGCAGTGCATTGAATGCAA
GTCCTGCAGCCTGTGTGGCACCTCGGAGAATGACGACCAGCTGCTGTTCTGTGATGACTGCGATCGAGGT
TACCACATGTACTGCCTGAGCCCTCCCATGGCGGAGCCCCCGGAAGGGAGCTGGAGCTGCCACCTCTGTC
TCCGGCACTTGAAGGAAAAGGCCTCTGCTTACATCACCCTGACC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR206060 representing NM_013874
Red=Cloning site Green=Tags(s)

MATAIQNPLKSLGEDFYREAIEHCRSYNARLCAERSLRLPFLDSQTGVAQNNCYIWMEKTHRGPGLAPGQ
IYTYPARCWRKKRRLNILEDPRLRPCEYKIDCEAPLKKEGGLPEGPVLEALLCAETGEKKVELKEEETIM
DCQKQQLLEFPHDLEVEDLEEDIPRRKNRARGKAYGIGGLRKRQDTASLEDRDKPYVCDICGKRYKNRPG
LSYHYTHTHLAEEEGEEHTERHALPFHRKNNHKQFYKELAWVPEAQRKHTAKKAPDGTVIPNGYCDFCLG
GSKKTGCPEDLISCADCGRSGHPSCLQFTVNMTAAVRTYRWQCIECKSCSLCGTSENDDQLLFCDDCDRG
YHMYCLSPPMAEPPEGSWSCHLCLRHLKEKASAYITLT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_013874
ORF Size 1164 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_013874.2, NP_038902.1
RefSeq Size 2278 bp
RefSeq ORF 1167 bp
Locus ID 29861
UniProt ID Q9QX66
Cytogenetics 7 B1
MW 44.4 kDa
Summary May have an important role in developing neurons by participating in regulation of cell survival, possibly as a neurospecific transcription factor. Belongs to the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_013874" in other vectors (4)
SKU Description Size Price
MC205044 Dpf1 (untagged) - Mouse D4, zinc and double PHD fingers family 1 (Dpf1), (10ug) 10 ug
$457.00
MG206060 Dpf1 (tGFP-tagged) - Mouse neuronal d4 domain family member (Neud4) 10 ug
$657.00
MR206060L3 Lenti ORF clone of Dpf1 (Myc-DDK-tagged) - Mouse D4, zinc and double PHD fingers family 1 (Dpf1) 10 ug
$757.00
MR206060L4 Lenti ORF clone of Dpf1 (mGFP-tagged) - Mouse D4, zinc and double PHD fingers family 1 (Dpf1) 10 ug
$757.00

Plasmid Map for MR206060

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR206060
Circular map for MR206060

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products