OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ptges2 (NM_133783) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR205997
Ptges2 (Myc-DDK-tagged) - Mouse prostaglandin E synthase 2 (Ptges2)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA329982 Rabbit Polyclonal Anti-Ptges2 Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Ptges2 or NM_133783"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ptges2
Synonyms 0610038H10Rik; C79137; Gbf1; Mpges2; Pges2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR205997 representing NM_133783
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCAGGCGGCGCGCCTTTCGTGGGTGCTTGTCTCTAGCCGGTGCGCCCTGACTGAGGGGCTGCTCA
CACGACCCTGGCAGCCGCTCTCGGCACAGAGCCGGGCTGGCTTCACCAGGGTGGCTGCCGGAAGCCGGGG
CGCCGCGGTCCGCAAGGGGAGCCCGCGGTTGCTGGGGGCGGCGGCGCTGGCCCTGGGCGGCGCGCTGGGG
CTGTACCACACCGTGCGGTGGCACCAGCGTTCCCAGGACCTCCGCGCGGAGCGCTCGGCTGCGCAGCTGC
CCCTGTCGAACAGCCTGCAGCTGACCCTGTACCAGTACAAGACATGTCCCTTCTGCAGCAAAGTCCGTGC
CTTCCTCGACTTCCACTCCCTGCCCTATCAGGTGGTGGAGGTGAATCCCGTGAGAAGGACTGAGATCAAA
TTCTCCTCCTACAGGAAAGTGCCCATCTTGGTGGCCCAGGAAGGAGACAGCTTGCAACAGCTCAATGACT
CCTCTGTCATCATTAGTGCCCTCAAGACCTACCTGGTTTCAGGGCAGCCCCTGGAAGAGGTCATCACTTA
TTACCCACCCATGAAGGCCATGAATGACCAGGGCAAGGAGGTGACCGAGTTTTGCAACAAGTACTGGCTC
ATGCTGGACGAGAAGGAGGCCCAGCAGATGTATGGCGGGAAGGAAGCCAGGACGGAGGAGATGAAGTGGC
GGCAGTGGGCGGATGACTGGCTGGTGCATCTCATCTCTCCCAACGTGTACCGAACACCCGCTGAGGCCTT
GGCTTCCTTCGACTACATTGTCCGTGAGGGCAAGTTTGGGGCTGTGGAGGCTGCCATGGCCAAGTATGTG
GGCGCGGCTGCCATGTACCTCATCAGCAAGCGCCTCAAAAGCAGGCACCACCTGCAGGATGATGTACGGG
TAGACCTCTATGAAGCAGCCAACAAGTGGGTGACAGCCGTGGGTAAAGACCGGCCATTCATGGGGGGTCA
GAAGCCTAACCTTGCTGACCTGGCAGTGTATGGTGTGCTGCGAGTGATGGAGGGTCTGGAGGCCTTCGAC
GACCTGATGCGACACTCACACATCCAGCCTTGGTACCTGCGGATGGAGCGGGCCATTGAAGAAGCCCCCT
CGGTGCATCATGTCAACCCTAGCTGCAAAGAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR205997 representing NM_133783
Red=Cloning site Green=Tags(s)

MAQAARLSWVLVSSRCALTEGLLTRPWQPLSAQSRAGFTRVAAGSRGAAVRKGSPRLLGAAALALGGALG
LYHTVRWHQRSQDLRAERSAAQLPLSNSLQLTLYQYKTCPFCSKVRAFLDFHSLPYQVVEVNPVRRTEIK
FSSYRKVPILVAQEGDSLQQLNDSSVIISALKTYLVSGQPLEEVITYYPPMKAMNDQGKEVTEFCNKYWL
MLDEKEAQQMYGGKEARTEEMKWRQWADDWLVHLISPNVYRTPAEALASFDYIVREGKFGAVEAAMAKYV
GAAAMYLISKRLKSRHHLQDDVRVDLYEAANKWVTAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLEAFD
DLMRHSHIQPWYLRMERAIEEAPSVHHVNPSCKD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_133783
ORF Size 1152 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_133783.2, NP_598544.2
RefSeq Size 1969 bp
RefSeq ORF 1155 bp
Locus ID 96979
UniProt ID Q8BWM0
Cytogenetics 2 B
MW 43.8 kDa
Summary The protein encoded by this gene is a Golgi membrane-associated prostaglandin E synthase candidate, which is capable of catalyzing the conversion of prostaglandin H2 to prostaglandin E2 in vitro. However, a study using mice deficient of this gene suggests that this enzyme does not contribute to prostaglandin E2 biosynthesis in vivo. This protein is synthesized as a Golgi membrane-bound protein, but its N-terminal hydrophobic region is cleaved off during protein maturation to produce the predominant soluble truncated form that still retains the enzyme activity. This soluble protein also has been shown to activate the transcription regulated by a gamma-interferon-activated transcription element (GATE), possibly via an interaction with CAAAT/enhancer-binding protein-beta. provided by RefSeq, Oct 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_133783" in other vectors (4)
SKU Description Size Price
MC205660 Ptges2 (untagged) - Mouse prostaglandin E synthase 2 (Ptges2), (10ug) 10 ug
$457.00
MG205997 Ptges2 (tGFP-tagged) - Mouse prostaglandin E synthase 2 (Ptges2) 10 ug
$657.00
MR205997L3 Lenti ORF clone of Ptges2 (Myc-DDK-tagged) - Mouse prostaglandin E synthase 2 (Ptges2) 10 ug
$757.00
MR205997L4 Lenti ORF clone of Ptges2 (mGFP-tagged) - Mouse prostaglandin E synthase 2 (Ptges2) 10 ug
$757.00

Plasmid Map for MR205997

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR205997
Circular map for MR205997

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products