OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Stn1 (NM_175360) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR205901
Obfc1 (Myc-DDK-tagged) - Mouse oligonucleotide/oligosaccharide-binding fold containing 1 (Obfc1)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Stn1 or NM_175360"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Stn1
Synonyms 0610009H20Rik; 2310057J23Rik; AAF-44; AAF44; AI413458; Obfc1; RPA-32
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR205901 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGTGTGAATCCAGTCCAAGGGAAGAGGAGATCCCGCCCCTCTTTTGGGGTCTGGATCCTGTGTTTC
TAGCCTTTGCAAAACTCTACATCAAGGATATCCTGGAGATGAAGGAGTCCCAACAAGTGCCAGGTACATA
TTTTTACAACGGGCATCCAATAAGGCGGGTAGATATCATGGGAGCTGTCATCAGCGTGAAAGAAAGAGAG
ACTTTCTACAGCTACGGAGTGGACGATGCCACTGGGGTTATAAACTGCGTCTGCTGGAAGAAGCTGAGCA
ATGCTGAGTCTTCCTCAGACCCAGCTATTCTGAGCACTGCGAGAGAGCTTAGCATGACATCACAGCTTAA
GAAGCTGCAGGAGACCATCGAGCAGAAAACCAGGATAGGGATTGGAGATATCATCCGAGTCCGAGGCTCT
GTGCGCATGTTCCGAGAAGAGCGAGAGATCTGTGCCAACATTTATTATAAGGTGGACGATCCAGTGTGGA
ACATGCAAATCGCAAGGATGCTTGAGCTGCCCAAGCTCTACCAGAAGGTGTACGACCAGCCCTTCCGTAA
CCCAGCCCTACAGGAGGAGGAAGCACTAAACAATAAAGACAATTTGGATCTCGCTGGCCTCACATCTTTG
CTGAGTGAGAAAATTAAAGAATTCCTCCAGGAGAAGAAAATGCAAAGCTTCTACCAGCAGGAGTTAGAGA
CAGTGGAGTCTTTGCAGTCTCTGGCCAGTCGGCCTGTGACCCACAGCACGGGCTCGGACCAAGTGGAGTT
AAAGGACAGTGGCACTTCTGGCGTAGCGCAGAGAGTGTTTAAGAATGCTCTCCAGCTGCTTCAGGAAAAA
GGACTCGTGTTCCAGAGAGACAGTGGCTCTGATAAGCTGTACTACGTAACCACCAAAGACAAAGACCTGC
AGCAGAAGATCTACCACATCATTAAGGAAGACTGTCAGAAACCAAACCATATGGAGAAGGGCTGCCACCT
GCTACACATCCTGAAGTGCGTGCACCTCAACCTCCGCTGGGACCTGAGCAAGGCTGTGCTGCAGCGGGTG
CTGGAGCTCCTGGAGGACCAGAGTGACATCGTCAGCACCGCGGACCACTACTACGCGGCCTTC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR205901 protein sequence
Red=Cloning site Green=Tags(s)

MECESSPREEEIPPLFWGLDPVFLAFAKLYIKDILEMKESQQVPGTYFYNGHPIRRVDIMGAVISVKERE
TFYSYGVDDATGVINCVCWKKLSNAESSSDPAILSTARELSMTSQLKKLQETIEQKTRIGIGDIIRVRGS
VRMFREEREICANIYYKVDDPVWNMQIARMLELPKLYQKVYDQPFRNPALQEEEALNNKDNLDLAGLTSL
LSEKIKEFLQEKKMQSFYQQELETVESLQSLASRPVTHSTGSDQVELKDSGTSGVAQRVFKNALQLLQEK
GLVFQRDSGSDKLYYVTTKDKDLQQKIYHIIKEDCQKPNHMEKGCHLLHILKCVHLNLRWDLSKAVLQRV
LELLEDQSDIVSTADHYYAAF

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_175360
ORF Size 1113 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_175360.1, NM_175360.2, NP_780569.1
RefSeq Size 1878 bp
RefSeq ORF 1137 bp
Locus ID 108689
UniProt ID Q8K2X3
Cytogenetics 19 C3
MW 42.7 kDa
Summary Component of the CST complex proposed to act as a specialized replication factor promoting DNA replication under conditions of replication stress or natural replication barriers such as the telomere duplex. The CST complex binds single-stranded DNA with high affinity in a sequence-independent manner, while isolated subunits bind DNA with low affinity by themselves. Initially the CST complex has been proposed to protect telomeres from DNA degradation (PubMed:19854130). However, the CST complex has been shown to be involved in several aspects of telomere replication. The CST complex inhibits telomerase and is involved in telomere length homeostasis; it is proposed to bind to newly telomerase-synthesized 3' overhangs and to terminate telomerase action implicating the association with the ACD:POT1 complex thus interfering with its telomerase stimulation activity. The CST complex is also proposed to be involved in fill-in synthesis of the telomeric C-strand probably implicating recruitment and activation of DNA polymerase alpha (PubMed:22748632). The CST complex facilitates recovery from many forms of exogenous DNA damage; seems to be involved in the re-initiation of DNA replication at repaired forks and/or dormant origins. Required for efficicient replication of the duplex region of the telomere. Promotes efficient replication of lagging-strand telomeres. Promotes general replication start following replication-fork stalling implicating new origin firing. May be in involved in C-strand fill-in during late S/G2 phase independent of its role in telomere duplex replication (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_175360" in other vectors (4)
SKU Description Size Price
MC205841 Obfc1 (untagged) - Mouse oligonucleotide/oligosaccharide-binding fold containing 1 (Obfc1), (10ug) 10 ug
$457.00
MG205901 Obfc1 (tGFP-tagged) - Mouse oligonucleotide/oligosaccharide-binding fold containing 1 (Obfc1) 10 ug
$657.00
MR205901L3 Lenti ORF clone of Obfc1 (Myc-DDK-tagged) - Mouse oligonucleotide/oligosaccharide-binding fold containing 1 (Obfc1) 10 ug
$757.00
MR205901L4 Lenti ORF clone of Obfc1 (mGFP-tagged) - Mouse oligonucleotide/oligosaccharide-binding fold containing 1 (Obfc1) 10 ug
$757.00

Plasmid Map for MR205901

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR205901
Circular map for MR205901

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products