OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ppid (NM_026352) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR205715
Ppid (Myc-DDK-tagged) - Mouse peptidylprolyl isomerase D (cyclophilin D) (Ppid)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA363177 PPID Antibody - middle region
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Ppid or NM_026352"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ppid
Synonyms 4930564J03Rik; CYP-40; Ppidl; Ppif
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR205715 representing NM_026352
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCACGCATCCCCGGCAGCCAAGCCCTCCAACTCCAAGAACCCGCGAGTCTTCTTTGACGTGGACA
TCGGCGGGGAGCGAGTTGGCCGAATTGTTTTAGAATTGTTTGCAGATATTGTTCCCAAAACTGCAGAAAA
TTTTCGTGCGTTGTGTACAGGAGAAAAAGGAACTGGGTCCACGACCGGGAAGCCTCTCCATTTTAAAGGA
TGCCCTTTCCACCGAATTATTAAGAAATTTATGATTCAGGGTGGAGACTTCTCAAATCAGAATGGGACAG
GTGGCGAAAGTATTTATGGTGAAAAATTTGAAGATGAAAATTTTCATTATAAGCATGATCGGGAGGGTTT
GCTGAGCATGGCAAATGCAGGCCCCAATACGAATGGCTCTCAGTTCTTTATCACAACAGTTCCGACTCCT
CATCTGGACGGGAAACATGTGGTATTTGGTCAGGTCATAAAAGGACTAGGTGTGGCAAGGACGCTTGAAA
ATGTAGAGGTGAATGGTGAAAAACCTGCCAAACTCTGTGTTATTGCAGAATGTGGAGAATTGAAAGAAGG
GGATGACTGGGGAATCTTCCCCAAAGATGGCTCTGGTGACAGTCATCCAGACTTCCCTGAGGATGCAGAT
ATAGATTTAAAAGATGTAGATAAAATTTTATTAATATCTGAAGACTTAAAAAACATTGGAAATACTTTTT
TCAAGTCTCAGAACTGGGAGATGGCTATTAAAAAATATGCGAAGGTTTTAAGGTATGTGGATAGTTCAAA
GGCTGTTATTGAGAAAGCAGATAGATCCAGACTGCAACCTATAGCCTTAAGTTGTGTGCTGAATATTGGT
GCTTGTAAGCTGAAGATGTCAAATTGGCAGGGGGCAATTGACAGTTGCTTAGAGGCTCTTGAAATGGACC
CTTCAAATACTAAAGCACTATACCGAAAAGCGCAAGGATGGCAAGGATTGAAAGAATATGATCAAGCATT
GGCTGATCTTAAGAAGGCACAGGAGATAGCCCCAGGAGATAAAGCTATCCAGGCAGAATTGCTTAAAGTC
AAACAAATGATAAAGGCACAGAAAGATAAAGAGAAGGCCGTGTATGCAAAAATGTTTGCT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR205715 representing NM_026352
Red=Cloning site Green=Tags(s)

MSHASPAAKPSNSKNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGSTTGKPLHFKG
CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGPNTNGSQFFITTVPTP
HLDGKHVVFGQVIKGLGVARTLENVEVNGEKPAKLCVIAECGELKEGDDWGIFPKDGSGDSHPDFPEDAD
IDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYAKVLRYVDSSKAVIEKADRSRLQPIALSCVLNIG
ACKLKMSNWQGAIDSCLEALEMDPSNTKALYRKAQGWQGLKEYDQALADLKKAQEIAPGDKAIQAELLKV
KQMIKAQKDKEKAVYAKMFA

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_026352
ORF Size 1110 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026352.4
RefSeq Size 1728 bp
RefSeq ORF 1113 bp
Locus ID 67738
UniProt ID Q9CR16
Cytogenetics 3 E3
MW 41.2 kDa
Summary PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding. Proposed to act as a co-chaperone in HSP90 complexes such as in unligated steroid receptors heterocomplexes. Different co-chaperones seem to compete for association with HSP90 thus establishing distinct HSP90-co-chaperone-receptor complexes with the potential to exert tissue-specific receptor activity control. May have a preference for estrogen receptor complexes and is not found in glucocorticoid receptor complexes. May be involved in cytoplasmic dynein-dependent movement of the receptor from the cytoplasm to the nucleus. May regulate MYB by inhibiting its DNA-binding activity. Involved in regulation of AHR signaling by promoting the formation of the AHR:ARNT dimer; the function is independent of HSP90 but requires the chaperone activity region. Involved in regulation of UV radiation-induced apoptosis.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_026352" in other vectors (6)
SKU Description Size Price
MC204530 Ppid (untagged) - Mouse peptidylprolyl isomerase D (cyclophilin D) (Ppid), (10ug) 10 ug
$457.00
MG205715 Ppid (tGFP-tagged) - Mouse peptidylprolyl isomerase D (cyclophilin D) (Ppid) 10 ug
$657.00
MR205715L1 Lenti ORF clone of Ppid (Myc-DDK-tagged) - Mouse peptidylprolyl isomerase D (cyclophilin D) (Ppid) 10 ug
$757.00
MR205715L2 Lenti ORF clone of Ppid (mGFP-tagged) - Mouse peptidylprolyl isomerase D (cyclophilin D) (Ppid) 10 ug
$757.00
MR205715L3 Lenti ORF clone of Ppid (Myc-DDK-tagged) - Mouse peptidylprolyl isomerase D (cyclophilin D) (Ppid) 10 ug
$757.00
MR205715L4 Lenti ORF clone of Ppid (mGFP-tagged) - Mouse peptidylprolyl isomerase D (cyclophilin D) (Ppid) 10 ug
$757.00

Plasmid Map for MR205715

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR205715
Circular map for MR205715

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products