OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ada (NM_007398) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR205350
Ada (Myc-DDK-tagged) - Mouse adenosine deaminase (Ada)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Ada or NM_007398"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ada
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR205350 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCAGACGCCCGCATTCAACAAACCCAAAGTAGAGTTACACGTCCACCTGGATGGAGCCATCAAGC
CAGAAACCATCTTATACTTTGGCAAGAAGAGAGGCATCGCCCTCCCGGCAGATACAGTGGAGGAGCTGCG
CAACATTATCGGCATGGACAAGCCCCTCTCGCTCCCAGGCTTCCTGGCCAAGTTTGACTACTACATGCCT
GTGATTGCGGGCTGCAGAGAGGCCATCAAGAGGATCGCCTACGAGTTTGTGGAGATGAAGGCAAAGGAGG
GCGTGGTCTATGTGGAAGTGCGCTATAGCCCACACCTGCTGGCCAATTCCAAGGTGGACCCAATGCCCTG
GAACCAGACTGAAGGGGACGTCACCCCTGATGACGTTGTGGATCTTGTGAACCAGGGCCTGCAGGAGGGA
GAGCAAGCATTCGGCATCAAGGTCCGGTCCATTCTGTGCTGCATGCGCCACCAGCCCAGCTGGTCCCTTG
AAGTGTTGGAGCTGTGTAAGAAGTACAATCAGAAGACCGTGGTGGCTATGGACTTGGCTGGGGATGAGAC
CATTGAAGGAAGTAGCCTCTTCCCAGGCCACGTGGAAGCCTATGAGGGCGCAGTAAAGAATGGCATTCAT
CGGACCGTCCACGCTGGCGAGGTGGGCTCTCCTGAGGTTGTGCGCGAGGCTGTGGACATCCTCAAGACAG
AGAGGGTGGGACATGGTTACCACACCATCGAGGATGAAGCCCTCTACAACAGGCTACTGAAAGAAAACAT
GCACTTTGAGGTCTGCCCCTGGTCCAGCTACCTCACAGGCGCCTGGGATCCCAAAACGACGCATGCGGTT
GTTCGCTTCAAGAATGATAAGGCCAACTACTCACTCAACACAGACGACCCCCTCATCTTCAAGTCTACTC
TAGACACTGACTACCAGATGACCAAGAAAGACATGGGCTTCACTGAGGAGGAGTTCAAGCGACTGAACAT
CAACGCAGCGAAGTCAAGCTTCCTCCCAGAGGAAGAGAAGAAGGAACTTCTGGAACGGCTCTACAGAGAA
TACCAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR205350 protein sequence
Red=Cloning site Green=Tags(s)

MAQTPAFNKPKVELHVHLDGAIKPETILYFGKKRGIALPADTVEELRNIIGMDKPLSLPGFLAKFDYYMP
VIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVDPMPWNQTEGDVTPDDVVDLVNQGLQEG
EQAFGIKVRSILCCMRHQPSWSLEVLELCKKYNQKTVVAMDLAGDETIEGSSLFPGHVEAYEGAVKNGIH
RTVHAGEVGSPEVVREAVDILKTERVGHGYHTIEDEALYNRLLKENMHFEVCPWSSYLTGAWDPKTTHAV
VRFKNDKANYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEEEKKELLERLYRE
YQ

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_007398
ORF Size 1056 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007398.1, NM_007398.2, NM_007398.3, NM_007398.4, NP_031424.1
RefSeq Size 1701 bp
RefSeq ORF 1059 bp
Locus ID 11486
UniProt ID P03958
Cytogenetics 2 H3
MW 40 kDa
Summary Catalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine (PubMed:9272950). Plays an important role in purine metabolism and in adenosine homeostasis (PubMed:9272950, PubMed:10720488). Modulates signaling by extracellular adenosine, and so contributes indirectly to cellular signaling events (PubMed:11435465). Acts as a positive regulator of T-cell coactivation, by binding DPP4. Its interaction with DPP4 regulates lymphocyte-epithelial cell adhesion (By similarity). Enhances dendritic cell immunogenicity by affecting dendritic cell costimulatory molecule expression and cytokines and chemokines secretion (By similarity). Enhances CD4+ T-cell differentiation and proliferation (By similarity). Acts as a positive modulator of adenosine receptors ADORA1 and ADORA2A, by enhancing their ligand affinity via conformational change (By similarity). Stimulates plasminogen activation (By similarity). Plays a role in male fertility (By similarity). Plays a protective role in early postimplantation embryonic development (PubMed:9272950).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_007398" in other vectors (3)
SKU Description Size Price
MG205350 Ada (tGFP-tagged) - Mouse adenosine deaminase (Ada) 10 ug
$489.00 $657.00
MR205350L3 Lenti ORF clone of Ada (Myc-DDK-tagged) - Mouse adenosine deaminase (Ada) 10 ug
$757.00
MR205350L4 Lenti ORF clone of Ada (mGFP-tagged) - Mouse adenosine deaminase (Ada) 10 ug
$757.00

Plasmid Map for MR205350

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR205350
Circular map for MR205350

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products