OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Khdrbs3 (NM_010158) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR205226
Khdrbs3 (Myc-DDK-tagged) - Mouse KH domain containing, RNA binding, signal transduction associated 3 (Khdrbs3)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Khdrbs3 or NM_010158"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Khdrbs3
Synonyms Etle; Salp; SLM-2; Slm2; T-STAR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR205226 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAGAAGTACCTGCCGGAGCTGATGGCGGAGAAGGACTCTCTGGACCCCTCCTTCACGCACGCCC
TGCGCTTGGTGAACCGAGAAATAGAAAAGTTTCAAAAGGGAGAAGGCAAGGAGGAAGAGAAGTACATTGA
CGTGGTGATAAACAAGAACATGAAGCTGGGACAGAAGGTGCTGATTCCCGTGAAGCAGTTTCCCAAGTTC
AACTTTGTGGGGAAGCTTTTGGGTCCGCGTGGCAATTCCCTGAAGCGCTTACAAGAAGAAACGTTGACAA
AAATGTCCATCCTTGGCAAAGGTTCCATGAGAGACAAGGCAAAGGAGGAAGAGCTGAGGAAAAGTGGAGA
AGCGAAGTACTTTCACCTCAATGACGACCTGCACGTGCTCATTGAAGTGTTCGCACCCCCAGCAGAAGCA
TATGCCCGGATGGGGCACGCCTTGGAAGAGATCAAGAAATTCCTGATCCCTGACTATAATGATGAAATCA
GGCAAGCACAACTCCAGGAGTTAACATATTTGAATGGAGGTTCAGAAAATGCAGATGTCCCAGTGGTTCG
AGGGAAATCTACTTTGCGTACGAGAGGTGTAACTACACCAGCAATAACCAGGGGAAGAGGAGGAGTCACA
GCCAGGCCTGTTGCAGTTGGGGTACCACGTGGGACACCGACTCCCCGAGGAGTCCTTTCCACCCGAGGGC
CAGTGAGCCGGGGAAGAGGCCTTCTCACTCCCAGAGCAAGAGGTGTCCCCCCAACCGGATACAGACCTCC
CCCGCCACCCCCAACACAGGAGACCTATGGAGAGTATGACTATGACGATGGGTACGGTACTGCCTATGAT
GAGCAGAGCTATGACTCCTATGACAACAGCTACAGCACCCCAGCACAAAGTGCAGCTGATTACTACGATT
ATGGGCATGGACTCAGCGAGGACGCTTATGACTCCTATGGGCAAGAGGAATGGACTAACTCAAGACATAA
GGCTCCTTCGGCGAGGACGGCGAAGGGCGTCTACAGAGACCAGCCATATGGCAGATAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR205226 protein sequence
Red=Cloning site Green=Tags(s)

MEEKYLPELMAEKDSLDPSFTHALRLVNREIEKFQKGEGKEEEKYIDVVINKNMKLGQKVLIPVKQFPKF
NFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEA
YARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGSENADVPVVRGKSTLRTRGVTTPAITRGRGGVT
ARPVAVGVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYD
EQSYDSYDNSYSTPAQSAADYYDYGHGLSEDAYDSYGQEEWTNSRHKAPSARTAKGVYRDQPYGRY

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_010158
ORF Size 1038 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_010158.2, NP_034288.2
RefSeq Size 1954 bp
RefSeq ORF 1041 bp
Locus ID 13992
UniProt ID Q9R226
Cytogenetics 15 30.36 cM
MW 38.8 kDa
Summary RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. Binds preferentially to the 5'-AUUAAA-3' motif in vitro (PubMed:19457263). Binds optimally to RNA containing 5'-AUUAA-3' as a bipartite motif spaced by more than 15 nucleotides (By similarity). Binds poly(A). RNA-binding abilities are down-regulated by tyrosine kinase PTK6 (PubMed:15471878). Involved in splice site selection of vascular endothelial growth factor (By similarity). In vitro regulates CD44 alternative splicing by direct binding to purine-rich exonic enhancer (By similarity). Can regulate alternative splicing of neurexins NRXN1-3 in the laminin G-like domain 6 containing the evolutionary conserved neurexin alternative spliced segment 4 (AS4) involved in neurexin selective targeting to postsynaptic partners such as neuroligins and LRRTM family members. High concentrations in forebrain structures block splicing inclusion of NRXN1-3 AS4 exons while low concentrations favor their inclusion. Targeted, cell-type specific splicing regulation of NRXN1 at AS4 is involved in neuronal glutamatergic synapse function and plasticity and is linked to behavioral aspects (PubMed:22196734, PubMed:23637638, PubMed:24469635, PubMed:27174676). Regulates expression of KHDRBS2/SLIM-1 in defined neuron populations in the hippocampus by modifying its alternative splicing resulting in a transcript predicted to undergo nonsense-mediated decay (PubMed:25505328). Can bind FABP9 mRNA (PubMed:19916944). May play a role as a negative regulator of cell growth. Inhibits cell proliferation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_010158" in other vectors (4)
SKU Description Size Price
MC207268 Khdrbs3 (untagged) - Mouse KH domain containing, RNA binding, signal transduction associated 3 (Khdrbs3), (10ug) 10 ug
$503.00
MG205226 Khdrbs3 (tGFP-tagged) - Mouse KH domain containing, RNA binding, signal transduction associated 3 (Khdrbs3) 10 ug
$657.00
MR205226L3 Lenti ORF clone of Khdrbs3 (Myc-DDK-tagged) - Mouse KH domain containing, RNA binding, signal transduction associated 3 (Khdrbs3) 10 ug
$757.00
MR205226L4 Lenti ORF clone of Khdrbs3 (mGFP-tagged) - Mouse KH domain containing, RNA binding, signal transduction associated 3 (Khdrbs3) 10 ug
$757.00

Plasmid Map for MR205226

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR205226
Circular map for MR205226

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products