OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Elavl1 (BC016194) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR204748
Elavl1 (Myc-DDK-tagged) - Mouse ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (cDNA clone MGC:27577
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Elavl1 or BC016194"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Elavl1
Synonyms HUR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR204748 representing BC016194
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTAATGGTTATGAAGACCACATGGCGGAAGACTGCAGGGATGACATTGGGAGAACGAATTTAATTG
TCAACTACCTCCCTCAGAACATGACCCAAGAGGAACTACGAAGTCTGTTCAGCAGCATTGGCGAGGTTGA
ATCTGCAAAGCTTATTCGGGATAAAGTAGCAGGACACAGCTTGGGCTACGGTTTTGTGAACTATGTGACT
GCAAAAGATGCAGAGAGAGCAATCAGCACACTGAACGGCTTGAGACTCCAGTCCAAAACCATTAAGGTGT
CATATGCTCGCCCAAGCTCAGAGGTCATCAAAGATGCCAACTTATACATCAGTGGGCTCCCAAGGACCAT
GACACAGAAGGATGTGGAAGACATGTTTTCTCGGTTTGGGCGAATCATCAACTCCAGGGTCCTTGTGGAT
CAGACCACAGGTTTGTCCAGAGGGGTTGCCTTTATCCGGTTTGACAAACGGTCAGAAGCAGAAGAGGCAA
TTACCAGTTTCAATGGTCATAAACCCCCAGGTTCCTCCGAGCCCATCACAGTGAAGTTTGCAGCCAATCC
CAACCAGAACAAAAACATGGCTCTCCTCTCGCAGCTGTACCACTCGCCTGCTAGGCGGTTTGGAGGCCCT
GTACACCACCAGGCACAGAGATTCAGGTTCTCCCCTATGGGTGTAGATCACATGAGTGGGATTTCTGGTG
TCAATGTCCCCGGCAATGCTTCCTCGGGCTGGTGCATCTTCATCTACAACCTTGGGCAAGACGCCGATGA
GGGGATCCTCTGGCAGATGTTTGGCCCCTTTGGTGCAGTTACCAATGTGAAAGTGATTCGTGATTTCAAC
ACCAACAAGTGCAAAGGGTTTGGTTTTGTGACCATGACAAACTATGAAGAAGCTGCAATGGCCATAGCAA
GTCTGAACGGCTACCGCCTGGGGGACAAAATTTTACAGGTTTCCTTCAAAACCAACAAGTCCCACAAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR204748 representing BC016194
Red=Cloning site Green=Tags(s)

MSNGYEDHMAEDCRDDIGRTNLIVNYLPQNMTQEELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVT
AKDAERAISTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVD
QTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNMALLSQLYHSPARRFGGP
VHHQAQRFRFSPMGVDHMSGISGVNVPGNASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFN
TNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFKTNKSHK

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN BC016194
ORF Size 978 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC016194
RefSeq Size 2475 bp
RefSeq ORF 980 bp
Locus ID 15568
Cytogenetics 8 2.0 cM
MW 90.8 kDa
Summary RNA-binding protein that binds to the 3' UTR region of mRNAs and increases their stability. Involved in embryonic stem cells (ESCs) differentiation: preferentially binds mRNAs that are not methylated by N6-methyladenosine (m6A), stabilizing them, promoting ESCs differentiation (PubMed:24394384). Binds to poly-U elements and AU-rich elements (AREs) in the 3' UTR of target mRNAs. Binds avidly to the AU-rich element in FOS and IL3/interleukin-3 mRNAs. In the case of the FOS AU-rich element, binds to a core element of 27 nucleotides that contain AUUUA, AUUUUA, and AUUUUUA motifs. Binds preferentially to the 5'-UUUUAGUUU-3' motif in vitro (By similarity). With ZNF385A, binds the 3' UTR of p53/TP53 mRNA to control their nuclear export induced by CDKN2A. Hence, may regulate p53/TP53 expression and mediate in part the CDKN2A anti-proliferative activity. May also bind with ZNF385A the CCNB1 mRNA (PubMed:21402775). Increases the stability of the leptin mRNA harboring an AU-rich element (ARE) in its 3' UTR (PubMed:27616329).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"BC016194" in other vectors (3)
SKU Description Size Price
MG204748 Elavl1 (tGFP-tagged) - Mouse ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (cDNA clone MGC:27577 10 ug
$500.00
MR204748L3 Lenti ORF clone of Elavl1 (Myc-DDK-tagged) - Mouse ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (cDNA clone MGC:27577 10 ug
$600.00
MR204748L4 Lenti ORF clone of Elavl1 (mGFP-tagged) - Mouse ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (cDNA clone MGC:27577 10 ug
$600.00

Plasmid Map for MR204748

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR204748
Circular map for MR204748

file-alt Citations

Studying the mechanism of PLAGL2 overexpression and its carcinogenic characteristics based on 3'-untranslated region in colorectal cancer
Su, Li, Li et al
Int. J. Oncol. (2018)
AI Summary: OriGene contributed to this study by providing plasmid constructs used to investigate the regulatory mechanisms and carcinogenic role of PLAGL2 in colorectal cancer.
Snippet: miR-486-5p mimics (5'-UCCUGUACUGAGCUGCCCCGAG-3') and miR-NC (5'-UUUGUACUACACAAAAGUACUG-3') were purchased from Guangzhou RiboBio Co., Ltd., and plasmid constructs were purchased from OriGene Technologies, Inc. (Rockville, MD, USA
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products