OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cops6 (NM_012002) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR204710
Cops6 (Myc-DDK-tagged) - Mouse COP9 (constitutive photomorphogenic) homolog, subunit 6 (Arabidopsis thaliana) (Cops6)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Cops6 or NM_012002"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cops6
Synonyms Sgn3; VIP/MOV34
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR204710 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGCAGCTGCGGCGGGGGCGAATGGGAGCGGAGGCAGCAGCGGCATGGAAGTGGATGCAGCAG
TCCCCAGCGTGATGGCCTCCGGAGTGACTGGGAGTGTTTCCGTCGCTCTTCATCCCCTTGTCATCCTTAA
CATCTCAGACCATTGGATCCGCATGCGCTCCCAGGAGGGGCGGCCTATGCAGGTGATTGGGGCTCTGATC
GGGAAGCAGGAGGGGCGAAATATCGAAGTGATGAACTCCTTTGAGCTGCTGTCCCACACCGTGGAAGAGA
AGATTATCATTGACAAAGAATATTATTACACCAAGGAGGAGCAGTTTAAACAGGTTTTCAAGGAGCTGGA
GTTTCTGGGTTGGTATACCACAGGGGGGCCACCTGACCCCTCAGACATCCACGTCCATAAGCAGGTGTGT
GAGATAATTGAGAGTCCGCTCTTTCTGAAGTTGAACCCTATGACCAAGCACACAGATCTTCCTGTCAGCG
TTTTTGAGTCTGTCATCGATATAATCAATGGAGAGGCCACAATGCTGTTTGCTGAGCTCACTTACACTCT
GGCCACTGAGGAAGCTGAACGGATCGGTGTAGACCACGTGGCCCGGATGACAGCAACAGGCAGTGGGGAG
AACTCCACTGTGGCTGAACACCTGATAGCTCAGCATAGTGCCATCAAGATGCTGCACAGCCGTGTGAAGC
TCATTTTAGAATATGTCAAGGCCTCTGAAGCAGGAGAGGTTCCCTTCAACCATGAGATCCTGCGGGAGGC
CTATGCCCTATGTCACTGTCTTCCAGTTCTCAGCACTGACAAGTTCAAGACAGACTTTTATGATCAATGC
AATGACGTGGGGCTCATGGCCTACCTCGGCACCATCACCAAAACGTGCAACACAATGAACCAGTTTGTGA
ACAAGTTCAACGTCCTCTACGACCGACAAGGCATTGGCCGGCGAATGCGGGGACTGTTTTTC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR204710 protein sequence
Red=Cloning site Green=Tags(s)

MAAAAAAGANGSGGSSGMEVDAAVPSVMASGVTGSVSVALHPLVILNISDHWIRMRSQEGRPMQVIGALI
GKQEGRNIEVMNSFELLSHTVEEKIIIDKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVC
EIIESPLFLKLNPMTKHTDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERIGVDHVARMTATGSGE
NSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQC
NDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRMRGLFF

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_012002
ORF Size 972 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012002.3
RefSeq Size 1094 bp
RefSeq ORF 975 bp
Locus ID 26893
UniProt ID O88545
Cytogenetics 5 G2
MW 35.9 kDa
Summary Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Has some glucocorticoid receptor-responsive activity (By similarity). Stabilizes COP1 through reducing COP1 auto-ubiquitination and decelerating COP1 turnover rate, hence regulates the ubiquitination of COP1 targets, including SFN (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_012002" in other vectors (4)
SKU Description Size Price
MC200798 Cops6 (untagged) - Mouse COP9 (constitutive photomorphogenic) homolog, subunit 6 (Arabidopsis thaliana) (Cops6), (10ug) 10 ug
$300.00
MG204710 Cops6 (tGFP-tagged) - Mouse COP9 (constitutive photomorphogenic) homolog, subunit 6 (Arabidopsis thaliana) (Cops6) 10 ug
$500.00
MR204710L3 Lenti ORF clone of Cops6 (Myc-DDK-tagged) - Mouse COP9 (constitutive photomorphogenic) homolog, subunit 6 (Arabidopsis thaliana) (Cops6) 10 ug
$600.00
MR204710L4 Lenti ORF clone of Cops6 (mGFP-tagged) - Mouse COP9 (constitutive photomorphogenic) homolog, subunit 6 (Arabidopsis thaliana) (Cops6) 10 ug
$600.00

Plasmid Map for MR204710

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR204710
Circular map for MR204710

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products