OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Sdc1 (NM_011519) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR204418
Sdc1 (Myc-DDK-tagged) - Mouse syndecan 1 (Sdc1)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Sdc1 or NM_011519"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Sdc1
Synonyms AA408134; AA409076; CD138; Sstn; syn-1; Synd; Synd1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR204418 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGACGCGCGGCGCTCTGGCTTTGGCTCTGCGCGCTGGCGCTGCGCCTGCAGCCTGCCCTCCCGCAAA
TTGTGGCTGTAAATGTTCCTCCTGAAGATCAGGATGGCTCTGGGGATGACTCTGACAACTTCTCTGGCTC
TGGCACAGGTGCTTTGCCAGATACTTTGTCACGGCAGACACCTTCCACTTGGAAGGACGTGTGGCTGTTG
ACAGCCACGCCCACAGCTCCAGAGCCCACCAGCAGCAACACCGAGACTGCTTTTACCTCTGTCCTGCCAG
CCGGAGAGAAGCCCGAGGAGGGAGAGCCTGTGCTCCATGTAGAAGCAGAGCCTGGCTTCACTGCTCGGGA
CAAGGAAAAGGAGGTCACCACCAGGCCCAGGGAGACCGTGCAGCTCCCCATCACCCAACGGGCCTCAACA
GTCAGAGTCACCACAGCCCAGGCAGCTGTCACATCTCATCCGCACGGGGGCATGCAACCTGGCCTCCATG
AGACCTCGGCTCCCACAGCACCTGGTCAACCTGACCATCAGCCTCCACGTGTGGAGGGTGGCGGCACTTC
TGTCATCAAAGAGGTTGTCGAGGATGGAACTGCCAATCAGCTTCCCGCAGGAGAGGGCTCTGGAGAACAA
GACTTCACCTTTGAAACATCTGGGGAGAACACAGCTGTGGCTGCCGTAGAGCCCGGCCTGCGGAATCAGC
CCCCGGTGGACGAAGGAGCCACAGGTGCTTCTCAGAGCCTTTTGGACAGGAAGGAAGTGCTGGGAGGTGT
CATTGCCGGAGGCCTGGTGGGCCTCATCTTTGCTGTGTGCCTGGTGGCTTTCATGCTGTACCGGATGAAG
AAGAAGGACGAAGGAAGCTACTCCTTGGAGGAGCCCAAACAAGCCAATGGCGGTGCCTACCAGAAACCCA
CCAAGCAGGAGGAGTTCTACGCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR204418 protein sequence
Red=Cloning site Green=Tags(s)

MRRAALWLWLCALALRLQPALPQIVAVNVPPEDQDGSGDDSDNFSGSGTGALPDTLSRQTPSTWKDVWLL
TATPTAPEPTSSNTETAFTSVLPAGEKPEEGEPVLHVEAEPGFTARDKEKEVTTRPRETVQLPITQRAST
VRVTTAQAAVTSHPHGGMQPGLHETSAPTAPGQPDHQPPRVEGGGTSVIKEVVEDGTANQLPAGEGSGEQ
DFTFETSGENTAVAAVEPGLRNQPPVDEGATGASQSLLDRKEVLGGVIAGGLVGLIFAVCLVAFMLYRMK
KKDEGSYSLEEPKQANGGAYQKPTKQEEFYA

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_011519
ORF Size 933 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_011519.1, NM_011519.2, NP_035649.1
RefSeq Size 3057 bp
RefSeq ORF 936 bp
Locus ID 20969
UniProt ID P18828
Cytogenetics 12 3.94 cM
MW 32.9 kDa
Summary Cell surface proteoglycan that bears both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix. Regulates exosome biogenesis in concert with SDCBP and PDCD6IP.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_011519" in other vectors (4)
SKU Description Size Price
MC200639 Sdc1 (untagged) - Mouse syndecan 1 (Sdc1), (10ug) 10 ug
$300.00
MG204418 Sdc1 (tGFP-tagged) - Mouse syndecan 1 (Sdc1) 10 ug
$500.00
MR204418L3 Lenti ORF clone of Sdc1 (Myc-DDK-tagged) - Mouse syndecan 1 (Sdc1) 10 ug
$600.00
MR204418L4 Lenti ORF clone of Sdc1 (mGFP-tagged) - Mouse syndecan 1 (Sdc1) 10 ug
$600.00

Plasmid Map for MR204418

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR204418
Circular map for MR204418

file-alt Citations

The Laminin-α1 Chain-Derived Peptide, AG73, Binds to Syndecans on MDA-231 Breast Cancer Cells and Alters Filopodium Formation
Puchalapalli, Mu, Edwards et al
Anal Cell Pathol (Amst) (2019) 2019, 9192516 DOI: 10.1155/2019/9192516
AI Summary: OriGene products contributed to this study by providing specific plasmids for syndecan (Sdc) overexpression, including mouse Sdc1 (Cat# MR223297), Sdc2 (Cat# MR226779), and Sdc4 (Cat# MR207872), which were used to rescue and analyze filopodium formation in MDA-231 breast cancer cells.
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products